KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_11100Help
Entry
BSUW23_11100      CDS       T01302                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00260  Glycine, serine and threonine metabolism
bss00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01130  Biosynthesis of antibiotics
bss01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSUW23_11100 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSUW23_11100 (trpA)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSUW23_11100 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ADM38260
UniProt: A3F3I3
Position
complement(2223350..2224153)
Genome map
AA seq 267 aa AA seqDB search
MFKLDLQASEKLFIPFITAGDPSPEVSVKLAKSLQKAGATALELGVAYSDPLADGPVIQR
ASKRALDHGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRKNHIDGL
LVPDLPLEESASLQADCKNHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRN
EFNSSVYPFIRTVKDLSTVPVAVGFGISNREQVMKMNEICDGVVVGSALVRKIEELKDRL
ISTETRDQALQEFEDYARAFGGLYSLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattagatcttcaagcatcagaaaaattgtttatcccgtttattacagcggga
gatccatcgcctgaggtttcggttaaactggcgaagtcactccaaaaagcaggtgccacg
gcactggagcttggtgttgcatactcagacccgcttgcagacggtccggtgatccagcgt
gcttcaaagcgggcgcttgatcatggaatgaatatcgtaaaggcaatcgaattaggcggg
gaaatgaaaaaaaacggagtgaatattccgattatcctctttacgtattataatcctgtg
ttacaattgaacaaagaatactttttcgctttactgcggaaaaatcacattgacggtctg
cttgttccggatctgccattagaagaaagcgccagccttcaagcggattgcaaaaaccat
gaggtaacgtatatttctttagttgcgccgacaagcgaaagccgtttgaaaaccattatt
gaacaagccgagggcttcgtctactgtgtatcttctctaggtgtgaccggtgtccgcaat
gagttcaattcatccgtgtacccgttcatccggacagtgaaggatctcagcactgttccg
gttgctgtcgggttcggtatatcaaaccgcgaacaggtcatgaagatgaatgaaatttgt
gacggtgtcgtagtgggaagtgcgctcgtcagaaaaatagaagagctaaaggaccggctc
atcagcactgaaacgagagatcaagcgctgcaggagtttgaagattacgcaagggcgttt
ggcggcttgtatagtttaaaatga

DBGET integrated database retrieval system