KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_11100Help
Entry
BSUW23_11100      CDS       T01302                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSUW23_11100 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSUW23_11100 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSUW23_11100 (trpA)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSUW23_11100 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2223350..2224153)
Genome map
AA seq 267 aa AA seqDB search
MFKLDLQASEKLFIPFITAGDPSPEVSVKLAKSLQKAGATALELGVAYSDPLADGPVIQR
ASKRALDHGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRKNHIDGL
LVPDLPLEESASLQADCKNHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRN
EFNSSVYPFIRTVKDLSTVPVAVGFGISNREQVMKMNEICDGVVVGSALVRKIEELKDRL
ISTETRDQALQEFEDYARAFGGLYSLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattagatcttcaagcatcagaaaaattgtttatcccgtttattacagcggga
gatccatcgcctgaggtttcggttaaactggcgaagtcactccaaaaagcaggtgccacg
gcactggagcttggtgttgcatactcagacccgcttgcagacggtccggtgatccagcgt
gcttcaaagcgggcgcttgatcatggaatgaatatcgtaaaggcaatcgaattaggcggg
gaaatgaaaaaaaacggagtgaatattccgattatcctctttacgtattataatcctgtg
ttacaattgaacaaagaatactttttcgctttactgcggaaaaatcacattgacggtctg
cttgttccggatctgccattagaagaaagcgccagccttcaagcggattgcaaaaaccat
gaggtaacgtatatttctttagttgcgccgacaagcgaaagccgtttgaaaaccattatt
gaacaagccgagggcttcgtctactgtgtatcttctctaggtgtgaccggtgtccgcaat
gagttcaattcatccgtgtacccgttcatccggacagtgaaggatctcagcactgttccg
gttgctgtcgggttcggtatatcaaaccgcgaacaggtcatgaagatgaatgaaatttgt
gacggtgtcgtagtgggaagtgcgctcgtcagaaaaatagaagagctaaaggaccggctc
atcagcactgaaacgagagatcaagcgctgcaggagtttgaagattacgcaagggcgttt
ggcggcttgtatagtttaaaatga

DBGET integrated database retrieval system