KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_11105Help
Entry
BSUW23_11105      CDS       T01302                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSUW23_11105 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSUW23_11105 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSUW23_11105 (trpB)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSUW23_11105 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2224146..2225348)
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGDFGGKFVPETLMQPLEEIETAFKEIKDDPVFRNEYYKLLHDYSGRPTA
LTFADRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKSKIIAETGAGQHGV
AAATVAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKHIEGTLPDKVVACVGGGSNA
IGMFQAFLDEDVELIGAEAAGKGIDTPLHAATMSKGTVGVIHGSLTYLIQDEFGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYDSITDEEAVDALKLLSEKEGILPAIESAHALAKA
FKLAKEMDRNQSILVCLSGRGDKDVNTLMNVLEEEVKAHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccgaatgaaataggcagatacggcgattttggcggaaagtttgttccg
gaaacactgatgcagccgttagaagaaattgaaaccgcatttaaagagatcaaggatgat
cctgtttttcgtaatgaatattacaagctgttacatgactattccggtaggccgactgca
ctcacgtttgctgatcgagttactgagtacttaggcggcgcgaaaatttatttgaaacga
gaagatttaaaccatacagggtctcataaaatcaataatgcgttaggtcaagcgctgctc
gctaagaaaatgggaaaatcgaaaatcattgctgaaaccggtgccggtcagcacggtgtt
gccgctgccacagtcgcagccaaattcggcttttcttgcactgtgtttatgggcgaggag
gatgttgcccgccagtctctgaacgttttccgcatgaagcttcttggggcggaagttgtt
cctgtaacaagcggaaatggcacattgaaggatgccacaaatgaggcgattcggtattgg
gttcaacattgcgaggatcatttttacatgattggatcagttgtcggaccgcacccttat
ccgcaggtggtccgagaatttcagaaaatgattggagaggaagcgaaggatcagctgaaa
cacattgaaggcactctgcctgataaagtagtggcgtgtgtaggtggaggaagcaatgcg
ataggcatgtttcaggcgtttttagacgaagatgttgaactgatcggcgctgaagcagcc
ggaaaaggaattgatactcctcttcatgccgctactatgtcgaaaggaaccgtaggcgtt
attcacggttcattgacttatctgattcaagatgagttcgggcaaattattgagccttac
tccatttcagcaggacttgactatcctggaatcggtccggagcacgcatatttgcataag
agcggccgtgtcacttatgacagtatcacagatgaagaagcggtggatgcattaaaactc
ttgtcagaaaaagaggggattttgccggcaatcgaatctgcccatgcgttagcaaaagca
ttcaaactcgccaaagagatggatcgcaatcaatccattctcgtctgtttatcaggacgg
ggagataaggatgtcaacacattaatgaatgtattggaagaagaggtgaaagcgcatgtt
taa

DBGET integrated database retrieval system