KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_11910Help
Entry
BSUW23_11910      CDS       T01302                                 

Gene name
ptb
Definition
phosphate butyryl coenzyme A transferase (EC:2.3.1.19)
Orthology
K00634  
phosphate butyryltransferase [EC:2.3.1.19]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bss00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2360395..2361294)
Genome map
AA seq 299 aa AA seqDB search
MKLKDLIGKASMYKNKTIAVAHAEDEEVIRAVKLAAEHLSARFLLVGDSKKLNDLTSSIQ
GHHVEIVHADSPEESAKLAVRAVHHKTADVLMKGNVPTSVLLKAVLNRQEGLRSTSVLSH
VAVFDIPDFDRLMFVTDSAMNIAPSLEELRQILQNAVHVAHAVGNNMPKAAALAAVETVN
PKMEATVNAAALAQMCKRGQIKGCTVDGPLALDNAISQIAAAQKKISGNVAGSADILLVP
TIEAGNILYKSLIYFAKASVAAVITGAKAPIALTSRADSAENKLYSIALAICASEEYTH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaagatttgatcggcaaagcgtcgatgtacaaaaacaagaccattgcggtt
gcccatgctgaggatgaggaagtgatccgggctgtaaagctggcagccgagcacctatcc
gcccgttttttgttagtgggcgacagcaagaaactaaacgatctgacatcatctattcaa
gggcatcatgtggaaatcgttcatgccgattcgcctgaggaatcggcaaaattagcagtc
cgtgctgtacatcataaaacagcggacgttttaatgaaagggaatgtgccgacttctgtt
ttgcttaaagcggtgttgaacagacaagaggggcttcggtcaaccagtgtcctttcccac
gtggctgtgtttgatataccggactttgacagattgatgtttgtgacagattcggctatg
aatattgccccttcgctggaagagcttcggcagattttgcaaaacgccgttcatgtggct
catgcagtagggaacaatatgccaaaagcagctgctctggcagcggtcgaaacggtgaac
ccgaaaatggaagcgacagtgaatgctgctgctcttgctcaaatgtgcaaaagaggccag
atcaaaggctgcactgttgatggaccgcttgctttggataacgcaatatcacaaattgct
gcagcccagaaaaagatttcgggaaatgtagcgggcagcgctgatatccttctcgtcccg
acaattgaggccggcaatattttatataaatcactaatctattttgcaaaggccagcgtg
gcggctgtcattacaggagcaaaagcgccgattgccttaacgagcagagcggactccgct
gaaaataaactgtattccattgcgctggcgatatgcgcatctgaagaatacacacattag

DBGET integrated database retrieval system