KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13285Help
Entry
BSUW23_13285      CDS       T01302                                 

Gene name
yrrC
Definition
exonuclease with DNA/RNA helicase motif
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bss03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2596363..2598759)
Genome map
AA seq 798 aa AA seqDB search
MQQHPDQLKLEEEPYLKGTVNTVIYHNDTNLYTVLKVKVTETSEAIEDKAVSVTGYFPAL
QEEETYTFYGKIVTHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSAINKILADASVLYDVPRLSKKKADTLAGALQQHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFGKADELGSRMGLSGNHPERIKAAILYTLETT
CLSEGHTYIETEQLIIDTQSLLNQSAREGQRITEMDAANAIIALGENKDIVIEDGRCYFP
SLFYAEQNVAKRVKHIANQTEYDDQFPESEFLLALGELEERMNVQYAPSQKEAIQKALSS
PMLLLTGGPGTGKTTVIRGIVELYGELHGVSLDPSAYKKDEAFPVVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHTEDQPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQI
IIVGDEDQLPSVGPGQVLRDLLASRVIPTVRLTDIYRQAEGSSIVELAHQMKNGLLPNNL
TAPTKDRSFIRCGGSQIKEVVEKVVANALKKGYTAKDIQVLAPMYRGKAGINELNIMLQD
ILNPPKEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMA
VVNFDGNEMTFTKKDFNQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAIT
RAKKFLILCGEEEALEWGVKNNDATVRQTSLKNRLSIQVEEMDAELEALQKELPFSVHDA
NIGMEGITPFDFMKEEQL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagcttaaactggaggaagagccctatttaaagggaacagtc
aacacagtcatctatcataatgacaccaatttatatacggttctgaaagtgaaagttaca
gagacctccgaagcgattgaagataaagccgtatccgtgacgggctacttccctgcgctt
caagaagaagagacctacacgttttacggaaagatcgtaacccatccaaaattcgggctc
caatttcaggcggagcatttcaaaaaggagatcccgacgactaaggaaggcatcattcaa
tatttatcgagtgatttgttcgagggaatcggcaaaaaaacagctgaagaaattgtgaaa
aagctgggcgacagcgcgattaataaaattttggctgacgcttcagtgctttatgatgta
ccgagactgtcaaaaaagaaagctgacacgctagccggtgcgttgcagcagcatcaggga
ctggagcaaatcatgatttccctgaatcagttcggctttggccctcagctgtctatgaaa
atctatcaggcctatgaatccgagacgcttgaaaagattcaggaaaacccttatcagctt
gtgaaagatgtagaagggatcgggtttgggaaagcggatgagcttggcagcagaatgggg
ctttcgggtaatcatcctgagcggataaaagccgcgattttgtacacgcttgaaacgact
tgtctgtcagaagggcatacgtacatagaaacggagcagctgattatcgacacccaatca
ctgttgaaccagtcagcaagggaaggacagcgtatcacagaaatggatgccgctaacgcg
attattgcccttggagaaaataaagacattgtcatagaagacggccgctgttattttcca
tcgctgttttacgcagaacaaaacgttgcaaagcgtgtgaaacatatcgcaaaccaaact
gaatatgatgaccagtttcctgaatcagaatttctgcttgctttaggcgaactggaagaa
cggatgaacgttcagtatgccccgagccagaaggaagcgattcaaaaagccctttcctca
ccgatgcttcttttaacgggaggcccaggaacagggaaaacgacggtaatcagaggaatt
gtcgaactgtacggggagcttcacggcgtgtcactagacccgtcagcttataaaaaggat
gaagcttttccggttgtattggccgcaccgacaggaagagcggcaaaacgaatgagtgaa
tcaacgggccttccggcagtcacgatacacaggctgcttggttggaacggcgcagaaggc
ttcacccatacagaggatcagccgatcgagggaaagctgttaattatcgatgaagccagt
atgcttgatatatggctggcgaaccacttgttcaaggcgatccctgatcatattcaaatc
atcattgtgggagacgaagatcagctgccttctgtcggtccgggccaagtgctgagagac
cttttggcatcccgggtgattccgactgtgagactgacagacatctaccgccaggcggag
gggtcatcaatcgtcgagcttgcccaccagatgaaaaatggattgctgccgaacaatttg
actgcacctacaaaggaccgttcttttattcgctgcggtggctcgcaaataaaagaagtg
gttgaaaaggttgtcgccaatgcattgaaaaaaggctatacggcaaaggacatacaggtt
ctcgccccgatgtacagaggaaaagccggcatcaatgaactgaatataatgctgcaggat
attttaaatcctcctaaagaaaaacggagagaattgaagttcggagatgttgtctacaga
accggagataaaattttgcagctcgtcaatcagccggaaaacaatgtattcaacggagat
attggggaaattacgtcgatattttatgcgaaggaaaatacagaaaaagaagacatggcc
gttgttaattttgacggcaatgaaatgacatttacgaaaaaagattttaaccaatttacc
catgcgtattgctgctctattcataaatcgcagggaagtgaatttccgattgtggttttg
cctgttgtgaaaggctactatagaatgctcagaagaaatcttctttataccgcgattacg
agagcaaagaaatttctcattttatgcggggaagaggaggcgctggagtggggcgtaaaa
aataatgacgcaactgtcagacagacttccttgaaaaacaggttgtcaatacaggttgag
gaaatggatgccgagcttgaggctttgcaaaaagagctcccgttcagtgtacacgatgcc
aatattggcatggaaggcattacaccattcgattttatgaaagaagaacagctataa

DBGET integrated database retrieval system