KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13435Help
Entry
BSUW23_13435      CDS       T01302                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bss03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2627548..2628153)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKERNQETIFTYHHIREDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIQAIENEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIENLFNHEERLEKQTAETALEEALEALRVLGYAEKEIKKVLPHL
KEDTGLTTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaatttgttaaaggcacgattgattatgtatctccccaatatattgtgatagag
aacggcggcattggctatcagattttcacgccgaatccgtttatatataaggagagaaac
caagaaacgatttttacgtaccatcatatcagagaggatgctttttcgctctacggtttt
tcaacaagagaggagaaggcgctctttacaaaacttttaaacgtgaccggaatcggtcca
aaaggcgcactcgccatcttgggctcaggtgatccgggagcggtaatccaagcgattgaa
aatgaagatgaagcctttttggtcaagtttcctggtgtaggaaagaaaaccgcgcgccag
attattcttgacttaaaaggaaaactcgctgatgttgtgcctgaaatgattgaaaatctg
tttaatcatgaagaaaggcttgaaaaacaaacagcagaaacagctctcgaagaagcgcta
gaggccctcagggttctcggatatgctgaaaaagaaattaaaaaggtgcttcctcactta
aaagaagatactggactcacaacagaccaatatgtgaaaaaagcattacaaaaactattg
aagtaa

DBGET integrated database retrieval system