KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13635Help
Entry
BSUW23_13635      CDS       T01302                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase (porphobilinogen synthase)
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00860  Porphyrin and chlorophyll metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSUW23_13635 (hemB)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BSUW23_13635 (hemB)
Exosome [BR:bss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSUW23_13635 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF2493
Motif
Other DBs
NCBI-ProteinID: ADM38764
UniProt: E0TV93
Position
complement(2665658..2666632)
Genome map
AA seq 324 aa AA seqDB search
MSQSFNRHRRLRSSKAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVYHVSLDL
LKDEVAELVKLGIQSVIVFGIPEEKDDCGTQAYHDHGIVQKAITEIKKHFPEMVVVADTC
LCEYTDHGHCGLVKDGVILNDASLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREALD
KEGFVNIPIMSYAVKYSSEFYGPFRDAANSTPQFGDRKTYQMDPANRMEALREAQSDVEE
GADFLIVKPSLSYMDIMRDVKNEFTLPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILT
SMKRAGADLIITYHAKDAAKWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcatttaacagacaccgccgtctgcggtcatcaaaagcaatgagagagatg
gtgaaagaaacgcgtttgcatccatctgattttatttatccgatttttgtcgttgaaggg
ctggaaggcaaaaaagctgttccgtcaatgcctgatgtttaccatgtatcattagatcta
ttgaaggatgaagtggcggagctggttaaactgggcattcaatctgtcatcgtgttcggc
atcccggaagaaaaagatgattgcggaacgcaagcgtaccatgatcacggcatcgttcaa
aaagccatcacagaaattaaaaaacacttccctgagatggttgtagtcgctgatacatgc
ttatgcgaatatacagaccacggccattgcggacttgtcaaagacggggtcatcctcaat
gatgcatcacttgagcttttagcccagacagctgtcagccaagcgaaagcaggtgctgat
atcattgcgccttcaaacatgatggacggatttgttacagtgatcagagaagcgcttgat
aaagaagggttcgtcaatattccaatcatgtcttatgctgtgaaatattcaagtgagttt
tacggtccgtttcgtgatgcagcaaacagcacgccgcaattcggggaccgcaaaacatat
cagatggaccctgccaaccgtatggaagcactccgcgaagcacaatcagatgtcgaggaa
ggcgcggactttttgattgtcaaaccttcgctttcctatatggatatcatgcgtgacgtg
aaaaatgagtttactttgccgctcgtcgcttataatgtaagcggagagtattctatggtg
aaggctgcagcgcagaacggctggatcaaagaaaaagaaattgtgttggaaattttgaca
agcatgaagcgtgcaggtgccgacctgattattacgtatcatgccaaagacgcagcgaaa
tggcttgcagagtaa

DBGET integrated database retrieval system