KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13640Help
Entry
BSUW23_13640      CDS       T01302                                 

Gene name
hemD
Definition
uroporphyrinogen III cosynthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSUW23_13640 (hemD)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSUW23_13640 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2666629..2667417)
Genome map
AA seq 262 aa AA seqDB search
MENDFPLKGKTVLVTRNKAQAKSFQQKVEALGGKAVLTSLITFRRALPNDLAKQVKEDLA
APGWLVFTSVNGVDFFFSYLKENQLILPAHKKIAAVGEKTACRLETHNVSVDVMPKDYIA
EQLAEALKQHAEQAERITVVKGNLSRDVIKQELVPLGFEVKEWVVYETIPDEEGIEALIE
AASQYSFDYVTFTSSSTVHTFMHVLGEELKKWKANRAACISIGPLTRDALLTYDITSHMP
DTFTIDGMLELMCSMSREEERI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgattttccgctgaaaggaaaaacagtgcttgtcacacggaataaggcgcag
gcaaaatcgtttcagcaaaaagtggaggcacttggcggaaaagcggttttgacctctttg
attacgtttcgccgcgctttgccgaatgatcttgcaaaacaggtgaaagaggatcttgcc
gcgcccggctggcttgtttttacaagtgtgaacggagtagacttctttttttcttatcta
aaggaaaatcagctcattctgccagcgcataaaaaaattgcggctgtcggtgaaaaaacg
gcttgccgtttggaaacgcataacgtatcggttgatgtgatgcctaaggactatattgct
gaacagttggcggaggcccttaagcagcatgctgaacaggcggaacgaattaccgtggtt
aaaggcaatttatcacgtgatgtgataaaacaggagcttgtcccgctcggttttgaagtg
aaggaatgggttgtttacgaaacgattccggatgaagaaggcatcgaggcactgatagag
gccgcgagtcaatattcatttgactatgtgacatttacgagttcatcaaccgtacatacg
tttatgcatgtcttgggagaagaattgaaaaagtggaaggcgaacagagcggcctgtatc
agcatcggacctttaacaagggacgctctgctgacgtatgacatcacatcgcatatgcct
gatacatttacaatagatggcatgcttgagttaatgtgcagcatgtcaagagaggaagag
agaatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system