KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13755Help
Entry
BSUW23_13755      CDS       T01302                                 

Gene name
ysnA
Definition
inosine/xanthosine triphosphate pyrophosphatase subunit A
Orthology
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BSUW23_13755 (ysnA)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BSUW23_13755 (ysnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2693517..2694104)
Genome map
AA seq 195 aa AA seqDB search
MKEAIIATHNPGKVKEFKEILEPKGYDVKSLAEIGFTEEIEETGHTFEENAILKAQAVAK
AVNKMVIADDSGLSIDNLGGRPGVYSARYAGEQKDDQANIAKVLSELKGIEKEQRTARFR
CALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSDEKNKIS
HRADALKKLSKLLEA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcaattattgcgacacataatccaggaaaagtgaaggaattcaaagaaatc
cttgagccaaaaggctatgatgtcaaatctttagctgaaattggattcacagaagaaatt
gaggaaacaggccatacgtttgaagaaaatgccattttgaaagctcaagctgttgccaaa
gcagtgaacaaaatggtgattgcggacgactccggtctgtccatcgataatcttggaggc
agaccaggcgtttattccgcccgctatgcaggggagcagaaagacgaccaggcaaatatc
gctaaagttctcagcgagctgaaaggaatcgaaaaagaacagcgcacggcccgtttccgg
tgcgcgctggctgtgagtatcccaggagaagaaacaaaaacagtcgaaggccatgttgaa
gggtatattgctgaagaaccgagaggagaatacggctttggctatgacccgatctttatt
gtgaaagataaagataagacaatggccgaactgacaagtgatgaaaaaaataaaatcagc
catagggctgacgcgcttaaaaagctgtctaagcttttggaggcataa

DBGET integrated database retrieval system