KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13845Help
Entry
BSUW23_13845      CDS       T01302                                 

Gene name
fadB
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BSUW23_13845 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BSUW23_13845 (fadB)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BSUW23_13845 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710143..2710919)
Genome map
AA seq 258 aa AA seqDB search
MNAISLAVDQFVAVLTIHNPPANALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSA
GADIKEFTSLKGNEDSSLLAERGQQLMERIEGFPKPIIAAIHGAALGGGLELAMACHIRI
AAEDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGREALNLGLVSIGA
KDEAEVFEKAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDA
KEGIQAFLEKRKPQFKGE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatttcactagcggttgatcaatttgtggcagtcttgacgatccacaatccg
ccggcaaatgcgctttccagccggatattagaagagctgtcctcctgtcttgatcaatgt
gagacagatgcaggcgtacgaagcattatcattcacggtgagggaagatttttctcagcc
ggggctgatattaaagaatttacatcgcttaaaggcaatgaggattcctcactgctggct
gagcgcggccagcagctaatggaaagaattgaaggcttcccaaaaccgattatcgcggca
attcacggtgctgctcttggaggcgggctggagcttgcgatggcttgtcatatcagaatt
gcggcagaagacgctaagctggggctaccggaacttaacctcggtatcataccgggtttt
gcgggaacacagcgtcttccgagatatgtcggtacagccaaagcactagagctcatcgga
tcaggagaaccgatatccggaagagaagcgcttaatctcggacttgtgtcaattggagca
aaagatgaagcagaagtgtttgaaaaagcaaaggcacttgccgctaagtttgcagaaaaa
agcccgcaaacgctggcatctctgcttgagcttctatattccaataaggtgtattcctat
gaaggcagcttaaagcttgaagcaaaacggtttggagaagcatttgagtcagaggacgcc
aaagaaggcatccaggcatttctcgaaaaaagaaagcctcagttcaaaggcgaataa

DBGET integrated database retrieval system