KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13845Help
Entry
BSUW23_13845      CDS       T01302                                 

Gene name
fadB
Definition
(GenBank) enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00071  Fatty acid degradation
bss00362  Benzoate degradation
bss01100  Metabolic pathways
bss01120  Microbial metabolism in diverse environments
bss01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BSUW23_13845 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSUW23_13845 (fadB)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BSUW23_13845 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADM38806
UniProt: E0TVX8
Position
complement(2710143..2710919)
Genome map
AA seq 258 aa AA seqDB search
MNAISLAVDQFVAVLTIHNPPANALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSA
GADIKEFTSLKGNEDSSLLAERGQQLMERIEGFPKPIIAAIHGAALGGGLELAMACHIRI
AAEDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGREALNLGLVSIGA
KDEAEVFEKAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDA
KEGIQAFLEKRKPQFKGE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatttcactagcggttgatcaatttgtggcagtcttgacgatccacaatccg
ccggcaaatgcgctttccagccggatattagaagagctgtcctcctgtcttgatcaatgt
gagacagatgcaggcgtacgaagcattatcattcacggtgagggaagatttttctcagcc
ggggctgatattaaagaatttacatcgcttaaaggcaatgaggattcctcactgctggct
gagcgcggccagcagctaatggaaagaattgaaggcttcccaaaaccgattatcgcggca
attcacggtgctgctcttggaggcgggctggagcttgcgatggcttgtcatatcagaatt
gcggcagaagacgctaagctggggctaccggaacttaacctcggtatcataccgggtttt
gcgggaacacagcgtcttccgagatatgtcggtacagccaaagcactagagctcatcgga
tcaggagaaccgatatccggaagagaagcgcttaatctcggacttgtgtcaattggagca
aaagatgaagcagaagtgtttgaaaaagcaaaggcacttgccgctaagtttgcagaaaaa
agcccgcaaacgctggcatctctgcttgagcttctatattccaataaggtgtattcctat
gaaggcagcttaaagcttgaagcaaaacggtttggagaagcatttgagtcagaggacgcc
aaagaaggcatccaggcatttctcgaaaaaagaaagcctcagttcaaaggcgaataa

DBGET integrated database retrieval system