KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_14190Help
Entry
BSUW23_14190      CDS       T01302                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSUW23_14190 (pfkA)
   01230 Biosynthesis of amino acids
    BSUW23_14190 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_14190 (pfkA)
   00030 Pentose phosphate pathway
    BSUW23_14190 (pfkA)
   00051 Fructose and mannose metabolism
    BSUW23_14190 (pfkA)
   00052 Galactose metabolism
    BSUW23_14190 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BSUW23_14190 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BSUW23_14190 (pfkA)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BSUW23_14190 (pfkA)
Protein phosphatases and associated proteins [BR:bss01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BSUW23_14190 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2782273..2783232)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
DTKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatttatcatgacgttgaagtttacggcatttacaacgga
tacgcaggattgatcagcggaaagattgaaaagcttgaactcggatctgttggcgatatt
atacatcgcggaggaacaaagctttatacggcaagatgtcctgaattcaaaacggttgaa
ggccgtgaaaaagggatagaaaacttgaaaaagcttggtattgaaggtcttgttgtcatc
ggcggagacggttcctatatgggtgcgaaaaaattaacagaacacgggtttccatgcgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtgatcgaagtaatgggacgtcatgccggtgatatcgcattgtgggcc
ggtcttgcagggggcgcggaatcaatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaaacacagtattattatcgtt
gccgaaggtgtaggcagcggtgttgagttcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtactgggccatatccagcgcggtggttctccaagcgctgctgac
cgcgtgctggcaagccgtcttggcgcatatgctgttgaactgctgctagaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatattg
gatacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system