KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_14190Help
Entry
BSUW23_14190      CDS       T01302                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00010  Glycolysis / Gluconeogenesis
bss00030  Pentose phosphate pathway
bss00051  Fructose and mannose metabolism
bss00052  Galactose metabolism
bss00680  Methane metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
bss01230  Biosynthesis of amino acids
bss03018  RNA degradation
Module
bss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bss_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_14190 (pfkA)
   00030 Pentose phosphate pathway
    BSUW23_14190 (pfkA)
   00051 Fructose and mannose metabolism
    BSUW23_14190 (pfkA)
   00052 Galactose metabolism
    BSUW23_14190 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BSUW23_14190 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BSUW23_14190 (pfkA)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BSUW23_14190 (pfkA)
Protein phosphatases and associated proteins [BR:bss01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BSUW23_14190 (pfkA)
Messenger RNA biogenesis [BR:bss03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BSUW23_14190 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADM38875
UniProt: E0TWL8
Structure
PDB: 

Jmol
Position
complement(2782273..2783232)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
DTKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatttatcatgacgttgaagtttacggcatttacaacgga
tacgcaggattgatcagcggaaagattgaaaagcttgaactcggatctgttggcgatatt
atacatcgcggaggaacaaagctttatacggcaagatgtcctgaattcaaaacggttgaa
ggccgtgaaaaagggatagaaaacttgaaaaagcttggtattgaaggtcttgttgtcatc
ggcggagacggttcctatatgggtgcgaaaaaattaacagaacacgggtttccatgcgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtgatcgaagtaatgggacgtcatgccggtgatatcgcattgtgggcc
ggtcttgcagggggcgcggaatcaatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaaacacagtattattatcgtt
gccgaaggtgtaggcagcggtgttgagttcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtactgggccatatccagcgcggtggttctccaagcgctgctgac
cgcgtgctggcaagccgtcttggcgcatatgctgttgaactgctgctagaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatattg
gatacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system