KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_14795Help
Entry
BSUW23_14795      CDS       T01302                                 

Gene name
ytpA
Definition
(GenBank) phospholipase component of bacilysocin synthesis or export
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSUW23_14795 (ytpA)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BSUW23_14795 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_5 PGAP1 Abhydrolase_2 Ser_hydrolase LCAT DUF1350 Thioesterase Chlorophyllase2 Abhydrolase_3 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ADM38996
UniProt: E0TY74
Position
complement(2907599..2908378)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVMIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDTWIDKARTFELPVFLLGHSMGGLVAIEWFKQQRNPHITGIILSSPCLGLQI
KVNKALDLASRGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTDAFLRVPLLVMQAGDDKLVDKTMVIKWFSGVASHNKAYREWEGLYHEIFN
EPEREVVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgccgtgattgtgatgatccacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggagatcttcgggttatcacgtt
gtcatgggcgacttgccgggtcaggggacaaccacaagggccagaggtcatattcgctca
tttcaagaatacattgatgaagtagatacttggatagataaagcacgaacctttgagctg
ccggtttttcttcttggtcacagcatgggcggcctggtcgcgattgaatggtttaaacag
caaagaaatccccatattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtcaataaagcgcttgaccttgcatcaagaggcctgaatgtcatcgctccgtcgctt
aaggttgattcgggattatcaattgatatggcgacacgtaatgaggacgtcatcgaggcc
gaccaaaatgactcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aaaactattgagtcagcgatggtgccgacagatgcgtttttaagagtgccgcttcttgtg
atgcaggccggtgacgataagcttgttgacaaaacgatggtcatcaagtggttttcaggt
gtagcttcccataataaagcgtacagagagtgggaagggctttatcatgaaatatttaat
gaacccgaaagagaagttgtctttaaagcggcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system