KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_14795Help
Entry
BSUW23_14795      CDS       T01302                                 

Gene name
ytpA
Definition
phospholipase component of bacilysocin synthesis or export
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bss00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2907599..2908378)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVMIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDTWIDKARTFELPVFLLGHSMGGLVAIEWFKQQRNPHITGIILSSPCLGLQI
KVNKALDLASRGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTDAFLRVPLLVMQAGDDKLVDKTMVIKWFSGVASHNKAYREWEGLYHEIFN
EPEREVVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgccgtgattgtgatgatccacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggagatcttcgggttatcacgtt
gtcatgggcgacttgccgggtcaggggacaaccacaagggccagaggtcatattcgctca
tttcaagaatacattgatgaagtagatacttggatagataaagcacgaacctttgagctg
ccggtttttcttcttggtcacagcatgggcggcctggtcgcgattgaatggtttaaacag
caaagaaatccccatattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtcaataaagcgcttgaccttgcatcaagaggcctgaatgtcatcgctccgtcgctt
aaggttgattcgggattatcaattgatatggcgacacgtaatgaggacgtcatcgaggcc
gaccaaaatgactcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aaaactattgagtcagcgatggtgccgacagatgcgtttttaagagtgccgcttcttgtg
atgcaggccggtgacgataagcttgttgacaaaacgatggtcatcaagtggttttcaggt
gtagcttcccataataaagcgtacagagagtgggaagggctttatcatgaaatatttaat
gaacccgaaagagaagttgtctttaaagcggcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system