KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_14975Help
Entry
BSUW23_14975      CDS       T01302                                 

Gene name
ytdA
Definition
(GenBank) putative UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00040  Pentose and glucuronate interconversions
bss00052  Galactose metabolism
bss00500  Starch and sucrose metabolism
bss00520  Amino sugar and nucleotide sugar metabolism
bss01100  Metabolic pathways
bss01130  Biosynthesis of antibiotics
Module
bss_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSUW23_14975 (ytdA)
   00052 Galactose metabolism
    BSUW23_14975 (ytdA)
   00500 Starch and sucrose metabolism
    BSUW23_14975 (ytdA)
   00520 Amino sugar and nucleotide sugar metabolism
    BSUW23_14975 (ytdA)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSUW23_14975 (ytdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADM39032
UniProt: E0TYB0
Position
complement(2941039..2941842)
Genome map
AA seq 267 aa AA seqDB search
MIKKAIIPAGGYGTRNLPVTKVIPKEMFPVGSKPVIHYIVEELKESGIEDILMVVSSHKN
LIVDYFDSSLALEAFLASRHKLHLLSEHPIPDIRIHYVRQPYAKGLGDAISFGKQFSGGE
PFAVVLPDDLIFSANQPALGQLIEAYTKYQCSVIGLKETKTEELHRYGVIKGEPVEKRLY
RIQDIVEKPKQNPPSHFAAAGRYIFTPDIFDELETLEADAGGEVQLTDAIKASLGACDVY
GKLLEGKRYDIGLQKDYLKLITDMLKT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagcgatcattcctgccggcggatacggaacgaggaatcttccggtgacg
aaggtgattccaaaagaaatgtttccggtgggatctaagcctgtgattcattatattgtt
gaggagctgaaggagtcaggcattgaagatattctgatggttgtatcaagccataaaaat
ctgattgtcgactattttgattcctctttggcgcttgaagcttttctggcctcccggcat
aaactgcatttactcagtgaacatccgattccggatatacggattcattatgtgcggcag
ccttatgcaaaaggtcttggcgacgcgatttcttttggaaagcaattttcaggcggggag
ccttttgccgtcgttttgcctgatgatctgatcttttccgctaatcagccggctttgggg
cagctgattgaagcgtatacgaaatatcagtgcagtgtgatcggcttaaaagaaacgaaa
acggaggaattgcaccgttacggtgtgataaaaggggagcctgttgaaaaaagactttat
cgcattcaggatattgtggaaaagcctaaacaaaacccgccatctcattttgccgcagca
ggacgttatatttttacaccggatatttttgacgagctggagacattagaagctgatgcc
ggaggggaagtgcagctaacggatgcgattaaagcttcactcggggcatgcgatgtttac
gggaaattgctggagggcaaacgatatgacatcggactgcaaaaggattatctgaagctg
attaccgatatgctgaaaacgtaa

DBGET integrated database retrieval system