KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_15725Help
Entry
BSUW23_15725      CDS       T01302                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSUW23_15725 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSUW23_15725 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSUW23_15725 (thrC)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BSUW23_15725 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3102537..3103595)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVM
YGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRLEGQKTAAFEVCEQLGEAPDVL
AIPVGNAGNISAYWKGFKEYHEKNGTSLPKMRGFEAEGSAAIVRNEVIENPETIATAIRI
GNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTNEDSILEYVKGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccatcaatataaagaatttttgcctgtaacagatcaaacaccg
gcgcttactttacatgaaggaaatacacctcttatccatctgccgaagctgtctgagcag
ctcggaattgagcttcatgtcaaaacagaaggtgtcaatcctacgggatcatttaaagac
cgcggaatggtcatggctgtggcgaaagcaaaagaagaaggcaacgatacgattatgtgc
gcttcaacaggaaacacttccgctgctgcggcagcatatgcagcccgcgccaacatgaaa
tgcatcgtcatcatcccgaacggaaaaatcgccttcggaaaacttgctcaggctgtcatg
tacggagccgagattattgcaattgatggaaactttgacgatgcgcttaaaattgtccgt
tccatctgtgagaaatcaccgattgctcttgtcaactcagtcaacccataccgccttgaa
ggtcaaaaaacagctgcctttgaagtgtgcgagcagctgggcgaagcaccggatgtatta
gcgatcccagtcggaaacgcaggcaatatctcagcgtattggaagggcttcaaggaatat
catgagaaaaacggcacaagcctcccgaaaatgcgaggatttgaagcggaaggctcggcg
gcaatcgttcgcaatgaagtaattgaaaatccggaaacaatagcaacagccattcgtatc
ggaaacccggcaagctgggacaaagctgtaaaggcagctgaggaatccaacgggaaaatt
gacgaagtcactgatgatgaaatccttcacgcgtatcagctgatcgcccgtgaagaaggc
gtgtttgcagaaccgggatcctgtgcttccattgctggcgttctgaaacaggtgaaatcc
ggagaaattccgaaaggcagcaaggtcgttgctgtgttaacaggaaacgggctgaaagat
ccgaatacagcggtcgacatttcagaaatcaagccggtcacattgccgacgaatgaagac
agcatccttgaatatgtaaaaggagcggcccgtgtatga

DBGET integrated database retrieval system