KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_15825Help
Entry
BSUW23_15825      CDS       T01302                                 

Gene name
pucL
Definition
urate oxidase with peroxide reductase N-terminal domain
Orthology
K16838  
urate oxidase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:1.7.3.3 4.1.1.97]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BSUW23_15825 (pucL)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BSUW23_15825 (pucL)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     BSUW23_15825 (pucL)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     BSUW23_15825 (pucL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3121914..3123398
Genome map
AA seq 494 aa AA seqDB search
MFTMDDMNQMDIQTLTDTLESIFEHSSWIAEKAAALRPFSSLSDLHHKMASIVKAADRQT
QLDLINKHPPLGTKNTMSVTSVREQQNAGLSKLEQEEYEEFLKLNERYYERFGFPFILAV
KGKTKQDIYQALLERLENERETEFHQALKEIYRIARFRLADIITEKGETQMKRTMSYGKG
NVFAYRTFLKPLTGVRQIPESSFTGRDNTVVGIDVTCEIGGDAFLTSFIDGDNTLVVATD
SMKNFIQSHLASYEGTTTEGFLHYVAHRFLDTYSHMDTITLTGEDIPFEAMPAYEGQELG
TSHLVFRRSRNERARSVLKAERTGDTITITEQYSEIMDLQLVKVSGNSFVGFIRDEYTTL
PEDGNRPLFVYLNICWQYENTDDARASDPARYVAAEQVRDLASTVFHELKTPSIQNLIYH
IGCRILTRFPQLTDVSFQSQNHTWDTVVEEIPGSKGKVYTEPRPPFGFQRFTVTREDAEK
EKQKAVEKLGSLKA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaatggatgacatgaaccaaatggacattcaaacactgacagacacgcttgaa
tctatttttgaacactcttcatggattgcggagaaagccgcggcattgcggccgttttct
tccctatctgatcttcaccacaaaatggccagcattgtaaaagccgcggaccgccagaca
cagcttgatttaatcaacaagcaccccccactcggaacaaagaatacaatgagcgtcacc
tcggtaagagagcagcaaaacgcgggactcagtaaacttgaacaagaggaatacgaagaa
tttctgaagctgaatgaacgctattatgaacgcttcggctttccttttattttagcggta
aagggaaagacgaaacaggacatttaccaagctctgctggaaaggcttgagaacgaacga
gaaacggagttccatcaggctcttaaagaaatttaccgcatcgcccgctttcggctggcg
gacatcataactgaaaaaggagagacgcaaatgaaaagaactatgtcttatggcaaagga
aatgtatttgcataccgaacgtttttaaagccgctcacaggggtacggcaaatccctgag
tcttcttttacagggagagacaatactgttgtcggcattgatgtgacgtgcgaaattggc
ggagatgcctttctgacatcatttatagacggagataatacactcgtcgtggctacagac
tcaatgaaaaactttattcagagccatctcgcttcctatgaagggacgacaaccgaggga
ttcttacactatgtggcacaccgatttttagatacctattctcatatggacactatcact
ctgacaggcgaagacattccgtttgaggcgatgcctgcatacgaggggcaagaactcggc
acaagccacctcgtctttagaagatcacgcaatgaacgcgctcggtctgtgctgaaagcg
gaacgaaccggggatacaataacgatcacagagcagtacagcgaaatcatggatcttcag
ctcgtcaaggtgagcggcaactccttcgtcggctttatccgggacgaatatacgactctc
ccggaggatggcaaccgccctctgtttgtctatttaaacatctgctggcagtatgaaaac
acagatgacgcacgcgcttctgatccagcccgctacgtcgcggctgaacaagtccgcgac
ttggcgagcaccgtttttcacgagctcaaaaccccttcaattcaaaatttaatctatcat
atcggctgcagaatattaacgagattcccgcagctcactgatgtcagcttccaatctcaa
aaccacacatgggatacagtcgttgaagagatcccagggtccaaaggaaaagtctacacc
gaaccgcgcccgccattcggtttccagcgctttaccgtgacaagagaagacgccgagaaa
gaaaaacagaaagccgtcgaaaaattagggagcctgaaagcctga

DBGET integrated database retrieval system