KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_15825Help
Entry
BSUW23_15825      CDS       T01302                                 

Gene name
pucL
Definition
urate oxidase with peroxide reductase N-terminal domain
Orthology
K16838  
urate oxidase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:1.7.3.3 4.1.1.-]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bss00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3121914..3123398
Genome map
AA seq 494 aa AA seqDB search
MFTMDDMNQMDIQTLTDTLESIFEHSSWIAEKAAALRPFSSLSDLHHKMASIVKAADRQT
QLDLINKHPPLGTKNTMSVTSVREQQNAGLSKLEQEEYEEFLKLNERYYERFGFPFILAV
KGKTKQDIYQALLERLENERETEFHQALKEIYRIARFRLADIITEKGETQMKRTMSYGKG
NVFAYRTFLKPLTGVRQIPESSFTGRDNTVVGIDVTCEIGGDAFLTSFIDGDNTLVVATD
SMKNFIQSHLASYEGTTTEGFLHYVAHRFLDTYSHMDTITLTGEDIPFEAMPAYEGQELG
TSHLVFRRSRNERARSVLKAERTGDTITITEQYSEIMDLQLVKVSGNSFVGFIRDEYTTL
PEDGNRPLFVYLNICWQYENTDDARASDPARYVAAEQVRDLASTVFHELKTPSIQNLIYH
IGCRILTRFPQLTDVSFQSQNHTWDTVVEEIPGSKGKVYTEPRPPFGFQRFTVTREDAEK
EKQKAVEKLGSLKA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaatggatgacatgaaccaaatggacattcaaacactgacagacacgcttgaa
tctatttttgaacactcttcatggattgcggagaaagccgcggcattgcggccgttttct
tccctatctgatcttcaccacaaaatggccagcattgtaaaagccgcggaccgccagaca
cagcttgatttaatcaacaagcaccccccactcggaacaaagaatacaatgagcgtcacc
tcggtaagagagcagcaaaacgcgggactcagtaaacttgaacaagaggaatacgaagaa
tttctgaagctgaatgaacgctattatgaacgcttcggctttccttttattttagcggta
aagggaaagacgaaacaggacatttaccaagctctgctggaaaggcttgagaacgaacga
gaaacggagttccatcaggctcttaaagaaatttaccgcatcgcccgctttcggctggcg
gacatcataactgaaaaaggagagacgcaaatgaaaagaactatgtcttatggcaaagga
aatgtatttgcataccgaacgtttttaaagccgctcacaggggtacggcaaatccctgag
tcttcttttacagggagagacaatactgttgtcggcattgatgtgacgtgcgaaattggc
ggagatgcctttctgacatcatttatagacggagataatacactcgtcgtggctacagac
tcaatgaaaaactttattcagagccatctcgcttcctatgaagggacgacaaccgaggga
ttcttacactatgtggcacaccgatttttagatacctattctcatatggacactatcact
ctgacaggcgaagacattccgtttgaggcgatgcctgcatacgaggggcaagaactcggc
acaagccacctcgtctttagaagatcacgcaatgaacgcgctcggtctgtgctgaaagcg
gaacgaaccggggatacaataacgatcacagagcagtacagcgaaatcatggatcttcag
ctcgtcaaggtgagcggcaactccttcgtcggctttatccgggacgaatatacgactctc
ccggaggatggcaaccgccctctgtttgtctatttaaacatctgctggcagtatgaaaac
acagatgacgcacgcgcttctgatccagcccgctacgtcgcggctgaacaagtccgcgac
ttggcgagcaccgtttttcacgagctcaaaaccccttcaattcaaaatttaatctatcat
atcggctgcagaatattaacgagattcccgcagctcactgatgtcagcttccaatctcaa
aaccacacatgggatacagtcgttgaagagatcccagggtccaaaggaaaagtctacacc
gaaccgcgcccgccattcggtttccagcgctttaccgtgacaagagaagacgccgagaaa
gaaaaacagaaagccgtcgaaaaattagggagcctgaaagcctga

DBGET integrated database retrieval system