KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_16480Help
Entry
BSUW23_16480      CDS       T01302                                 

Gene name
yvaK
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Brite
Enzymes [BR:bss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BSUW23_16480 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3247484..3248224)
Genome map
AA seq 246 aa AA seqDB search
MKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPEEL
VHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYQGVLSYARNYKKFEGKNPEQIEEEMKEFEKTPMNTLKALQNLIADVRNNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttttg
ctgcatggctttacaggaaatacagcggatgtaagaatgctgggacgttatttgaatgaa
cggggctatacgtgccacgcgcctcaatatgaaggacacggcgtgccccctgaagaacta
gtacatacggggcctgaagactggtggaaaaacgtgatggatggctatgaatacttaaaa
tctgaaggctatgagagcattgctgcctgcggactgtcgcttggcggggttttttcgctg
aaattgggttacactgtacccataaagggaattgttccaatgtgcgcaccgatgcatatt
aagagtgaagaggtcatgtatcagggcgtcctttcatacgctcgcaattacaaaaaattc
gaggggaaaaacccggagcaaattgaagaggaaatgaaggaattcgaaaaaacgccgatg
aacactcttaaggcgctgcaaaatttaattgccgatgtgcggaacaatgtcgatatgatt
tattcaccgacatttgtggtgcaggcacgtcatgatcacatgattaataccgaaagtgcc
aatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgaggaatca
ggccatgtcattacgctagacaaagaacgggacctcgtccatcaggatgtgtatgaattt
ttagagaagctcgattggtaa

DBGET integrated database retrieval system