KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_16660Help
Entry
BSUW23_16660      CDS       T01302                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSUW23_16660 (tpiA)
   01230 Biosynthesis of amino acids
    BSUW23_16660 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_16660 (tpiA)
   00051 Fructose and mannose metabolism
    BSUW23_16660 (tpiA)
   00562 Inositol phosphate metabolism
    BSUW23_16660 (tpiA)
Enzymes [BR:bss01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BSUW23_16660 (tpiA)
Exosome [BR:bss04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BSUW23_16660 (tpiA)
  Exosomal proteins of bladder cancer cells
   BSUW23_16660 (tpiA)
  Exosomal proteins of melanoma cells
   BSUW23_16660 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3279879..3280640)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKTVAESFSQEVADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatcgccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagcggaagctgttgtt
tgcgcgccagcacttttcttagaaaagcttacttctgctgttaaaggcactgatctaaaa
gtcggcgcacaaaacatgcacttcgaagaaagcggcgcgttcacaggcgaaatcagcccg
gttgctcttaaagaccttggcgttgactactgcgtcattggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcacatgctgctttcaaacacggc
attgtgccgatcatctgtgtaggtgaaacgcttgaagagcgcgaagccggtaaaacaaat
gatcttgttgctgaccaagtaaaaaaaggccttgctggtctttctgaagaacaagttgct
gcttctgttattgcgtatgagccaatctgggcaatcggaacaggcaaatcttctacagca
aaagatgcgaacgacgtgtgtgcgcatatccgtaaaaccgtcgctgaaagcttcagccaa
gaagttgcagacaagcttcgcatccaatatggcggaagcgtaaagcctgcaaacattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcgagccttgagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system