KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_16660Help
Entry
BSUW23_16660      CDS       T01302                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00010  Glycolysis / Gluconeogenesis
bss00051  Fructose and mannose metabolism
bss00562  Inositol phosphate metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
bss01230  Biosynthesis of amino acids
Module
bss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bss_M00002  Glycolysis, core module involving three-carbon compounds
bss_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_16660 (tpiA)
   00051 Fructose and mannose metabolism
    BSUW23_16660 (tpiA)
   00562 Inositol phosphate metabolism
    BSUW23_16660 (tpiA)
Enzymes [BR:bss01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BSUW23_16660 (tpiA)
Exosome [BR:bss04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BSUW23_16660 (tpiA)
  Exosomal proteins of bladder cancer cells
   BSUW23_16660 (tpiA)
  Exosomal proteins of melanoma cells
   BSUW23_16660 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADM39367
UniProt: E0U2U8
Position
complement(3279879..3280640)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKTVAESFSQEVADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatcgccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagcggaagctgttgtt
tgcgcgccagcacttttcttagaaaagcttacttctgctgttaaaggcactgatctaaaa
gtcggcgcacaaaacatgcacttcgaagaaagcggcgcgttcacaggcgaaatcagcccg
gttgctcttaaagaccttggcgttgactactgcgtcattggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcacatgctgctttcaaacacggc
attgtgccgatcatctgtgtaggtgaaacgcttgaagagcgcgaagccggtaaaacaaat
gatcttgttgctgaccaagtaaaaaaaggccttgctggtctttctgaagaacaagttgct
gcttctgttattgcgtatgagccaatctgggcaatcggaacaggcaaatcttctacagca
aaagatgcgaacgacgtgtgtgcgcatatccgtaaaaccgtcgctgaaagcttcagccaa
gaagttgcagacaagcttcgcatccaatatggcggaagcgtaaagcctgcaaacattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcgagccttgagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system