KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_16775Help
Entry
BSUW23_16775      CDS       T01302                                 

Gene name
ganA
Definition
arabinogalactan type I oligomer exo-hydrolase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSUW23_16775 (ganA)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BSUW23_16775 (ganA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3302938..3304998)
Genome map
AA seq 686 aa AA seqDB search
MSKLEKTHVTGAKFMLHGGDYNPDQWLDRPDILADDITLMKLSHTNTFSVGIFAWSALEP
EEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTYPEVLRVNASRVKQLHGGRH
NHCLTSQVYREKTRHINRLLAERYGNHPALLMWHISNEYGGECHCDLCQHAFREWLKSKY
DNSLKALNHAWWTPFWSHTFNDWSQIESPSPIGENGLHGLNLDWRRFVTDQTISFYENEI
IPLNELTPDIPITTNFMADTPDLIPYQGLDYSKFAKHVDVISWDAYPVWHNDWESTADLA
MKVGFINDLYRSLKQQPFLLMECTPSAVNWHNVNKAKRPGMNLLSSMQMIAHGSDSVLYF
QYRKSRGSSEKLHGAIVDHDNSPKNRVFQEVAKTGETLERLSEVVGTKRPAETAILYDWE
NHWALEDAQGFAKATKRYAQTLQQHYRTFWEHDIPVDVITKEQDFSPYKLLIVPMLYLIS
EDTISRLKTFTANGGALVMTYISGIVNEHDLTYTGGWHPDLQAIFGIEPLETDTLYPKDR
NAVSYRSQTYEMKDYATVIDVKTASAEAVYQEDFYARTPAVTSHQYQQGKAYFIGARLKD
QFHRDFYEGLITDLSLSPVFPVRHGKGVSVQARQDQDNDYIFVMNFTEEKQLVTFDHSVK
DMMTGDILSGDLTLEKYEVRIVVNTH
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagcttgaaaaaacgcacgtaacaggggcaaaatttatgcttcacggaggagac
tacaatcctgatcaatggctggatcgccctgatattttagccgatgatatcacgctgatg
aaactttctcatacgaatacgttttctgtcggcatttttgcatggagcgcgcttgagcca
gaggagggcgtataccaatttgaatggctggacgatatttttgaacgaattcacagcata
ggcggcagggtcatattagcaacaccaagcggagctcgtcctgcctggctgtcgcaaacc
tatcctgaagttttgcgcgtcaatgcctcccgtgtcaaacagcttcacggcggaaggcac
aaccactgcctcacatctcaagtctaccgtgaaaaaacacgtcacatcaatcggttacta
gcagaacgatacggcaatcatcctgcgctgttaatgtggcatatttcaaatgaatacgga
ggagagtgccactgcgatctatgccagcatgctttcagggagtggctgaaatcgaaatat
gacaacagtctcaaggcattgaaccatgcgtggtggactcctttttggagccacacattc
aatgactggtcacaaattgaaagcccttcgccgatcggtgaaaacggcttacacggcctg
aacttagactggcgccggttcgtcacagatcaaacgatttcgttttatgaaaatgaaatc
attccgctgaatgaactgacgcctgatatccctatcacaacgaactttatggctgacaca
ccggatttgattccgtatcagggcctagactacagcaaatttgcgaagcatgtcgatgtt
atcagctgggacgcttatccggtctggcacaatgactgggaaagcacagctgatttggcg
atgaaggtcggctttatcaatgacctgtaccggagcctgaagcagcagcctttcttatta
atggagtgtacgccaagcgcggtcaattggcataacgtcaacaaggcgaagcgcccgggc
atgaatctgctgtcgtccatgcaaatgattgcccacggttcggacagcgttctctatttc
caataccgcaaatcgcgcggatcatcagaaaaattgcacggggcaatagtagatcatgac
aatagcccgaagaaccgggtctttcaagaagtggccaaaaccggcgaaacattagaacgg
ctgtccgaggttgtcggaacgaagaggcccgctgaaacggctattttatatgactgggaa
aatcactgggcgctcgaggatgctcaggggtttgcgaaggcgacaaaacgttatgcgcaa
acgcttcagcagcattaccgcacgttctgggaacacgatatccctgtcgacgtcatcaca
aaagaacaggatttttcaccatataaactgttgatcgtcccgatgctatatttaatcagc
gaagacaccatttcccgtttgaaaacgtttacggctaacggcggcgccttagtcatgaca
tatatcagcgggattgtaaatgagcatgatttaacgtatacaggaggatggcatccggat
ttgcaagctattttcggaattgagcctcttgaaaccgacacgctatatccgaaggatcga
aatgctgtcagctatcgcagccaaacatatgaaatgaaggactatgcaaccgtgatcgat
gtcaagaccgcatcagcagaagcggtgtatcaagaagatttttacgcgcgtacgccagcg
gtgacaagccatcaatatcaacagggcaaggcgtattttatcggtgcgcgtttgaaggat
caatttcaccgggatttttatgaagggctcatcacagacctgtctctttctcctgttttt
ccggttcggcatggaaaaggtgtctccgtacaagcgaggcaggatcaggataatgattat
atttttgtcatgaattttacggaagaaaagcagttggtcacgtttgatcacagtgtgaag
gatatgatgacaggagacatattatcaggtgacctgacgctggaaaaatatgaagtcaga
attgtcgtaaatacacattag

DBGET integrated database retrieval system