KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_17510Help
Entry
BSUW23_17510      CDS       T01302                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSUW23_17510 (gtaB)
   00052 Galactose metabolism
    BSUW23_17510 (gtaB)
   00500 Starch and sucrose metabolism
    BSUW23_17510 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BSUW23_17510 (gtaB)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSUW23_17510 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3457727..3458605
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAETPGLRQLMDEYERTLSSIIGVQQVPDEETHRYGIIDPLTSDG
RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQIGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtacgtaaagccataatccctgccgcaggtctcggaacgagattcttgccg
gctacgaaagcaatgccgaaagaaatgcttcctatcgttgataagccaaccattcaatac
ataattgaagaagctgttgaagccggtattgaggatattattatcgtaacaggaaaaagc
aagcgtgcgattgaggatcattttgattactctcctgagcttgaaagaaacttagaagaa
aaaggaaagactgaactccttgaaaaagtgaaaaaagcttctaacctggctgatattcac
tatatccgccaaaaagagcctaagggactcggacacgctgtatggtgtgcgcgcaacttt
attggcgatgagccgtttgcggtcctgcttggagacgatattgttcaggcagaaacacca
ggattacgccaattaatggatgaatatgaaagaacactttcttctattatcggtgttcag
caagtacctgacgaagaaacacaccgctacggcattatcgacccgctgactagtgatggc
cgccgttaccaggtgaaaaacttcgttgagaagccgcctaaaggcactgcaccttctaac
cttgccatcttaggccgttacgtattcacacctgagatcttcatgtacttagaggagcag
cagattggcgccggcggagaaattcagctaacggatgccattcaaaagctaaatgaaatt
caaagagtgtttgcttacgactttgaaggcaagcgttatgatgttggtgaaaaactgggc
tttatcacaacaactcttgagtttgcgatgcaggataaagagcttcgcgatcagctcgtt
ccatttatggaaggtttattaaacaaagaagaaatctaa

DBGET integrated database retrieval system