KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_19325Help
Entry
BSUW23_19325      CDS       T01302                                 

Gene name
yxjF
Definition
dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bss00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bss00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3808527..3809300)
Genome map
AA seq 257 aa AA seqDB search
MKKQVALVTGAAGGIGFEIAREFAREGASVIVSDLHQEACEKAASKLAEEGFDAAAIPCD
VTKEAQVADTVNAIQKRYSRLDILVNNAGIQHIAPIEEFPTETFEQLIKVMLTAPFIAMK
HVFPIMKKQKFGRIINISSVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNAL
CPGYVDTKLVRNQLSDLSKTRNVPYDSVLEQVIFPLVPQKRLLSVKEIADYAVFLASEKA
KGITGQAVVLDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaagtcgccttggtgactggggcagccggcggaatcggattcgaaatcgcg
agggagttcgcccgtgaaggagctagcgtcatcgtttcggaccttcatcaggaagcatgc
gaaaaggccgcttccaagcttgcagaagaaggttttgacgcagcagccattccgtgtgat
gtgacaaaggaagcgcaagtcgctgatacggtaaacgccatccaaaaacgatacagccgc
ttggatattttggtgaacaatgccggtattcagcacatcgccccgattgaagagtttcca
acagaaacctttgaacagctgatcaaagtcatgctgacggcgcccttcatcgcgatgaag
catgtttttccgatcatgaaaaaacagaagtttggcagaatcattaatatctcgtctgtt
aatggtttagtcggctttgcgggaaaatccgcttataatagcgctaagcacggtgtcatt
ggactgacaaaggtcggggcgctggaaggcgcgccccacggcattacagtcaacgcgctc
tgtccgggatatgtcgatacaaagcttgtccgcaatcagctgagcgatctttcaaaaacg
agaaatgtcccttacgactccgtgcttgaacaggtcattttcccgcttgtgccgcaaaaa
cgattgctttccgtcaaggaaatcgcggattatgcggtgtttttggcaagcgagaaagca
aagggtatcaccgggcaggctgtcgtccttgatgggggctacaccgctcaataa

DBGET integrated database retrieval system