KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_19325Help
Entry
BSUW23_19325      CDS       T01302                                 

Gene name
yxjF
Definition
dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BSUW23_19325 (yxjF)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BSUW23_19325 (yxjF)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BSUW23_19325 (yxjF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3808527..3809300)
Genome map
AA seq 257 aa AA seqDB search
MKKQVALVTGAAGGIGFEIAREFAREGASVIVSDLHQEACEKAASKLAEEGFDAAAIPCD
VTKEAQVADTVNAIQKRYSRLDILVNNAGIQHIAPIEEFPTETFEQLIKVMLTAPFIAMK
HVFPIMKKQKFGRIINISSVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNAL
CPGYVDTKLVRNQLSDLSKTRNVPYDSVLEQVIFPLVPQKRLLSVKEIADYAVFLASEKA
KGITGQAVVLDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaagtcgccttggtgactggggcagccggcggaatcggattcgaaatcgcg
agggagttcgcccgtgaaggagctagcgtcatcgtttcggaccttcatcaggaagcatgc
gaaaaggccgcttccaagcttgcagaagaaggttttgacgcagcagccattccgtgtgat
gtgacaaaggaagcgcaagtcgctgatacggtaaacgccatccaaaaacgatacagccgc
ttggatattttggtgaacaatgccggtattcagcacatcgccccgattgaagagtttcca
acagaaacctttgaacagctgatcaaagtcatgctgacggcgcccttcatcgcgatgaag
catgtttttccgatcatgaaaaaacagaagtttggcagaatcattaatatctcgtctgtt
aatggtttagtcggctttgcgggaaaatccgcttataatagcgctaagcacggtgtcatt
ggactgacaaaggtcggggcgctggaaggcgcgccccacggcattacagtcaacgcgctc
tgtccgggatatgtcgatacaaagcttgtccgcaatcagctgagcgatctttcaaaaacg
agaaatgtcccttacgactccgtgcttgaacaggtcattttcccgcttgtgccgcaaaaa
cgattgctttccgtcaaggaaatcgcggattatgcggtgtttttggcaagcgagaaagca
aagggtatcaccgggcaggctgtcgtccttgatgggggctacaccgctcaataa

DBGET integrated database retrieval system