KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_19565Help
Entry
BSUW23_19565      CDS       T01302                                 

Gene name
bglH
Definition
aryl-phospho-beta-D-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_19565 (bglH)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSUW23_19565 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3853024..3854433)
Genome map
AA seq 469 aa AA seqDB search
MSSNTKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPFDESMTSINLYHT
GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLKFYDNLFDELLKHQ
IEPVVTISHYEMPLGLVKHYGGWKNRKVIEFYERYAKTVFKRYQRKVKYWMTFNEINVVL
HAPFTGGGLVFGEGENKLNAMYQAAHHQFVASALAVKAGHEIIPDSKIGCMIAATTTYPM
TSKPEDVFAALENERKTLFFSDVQARGAYPGYMKRYLAENNITIEMAEGDEEILKEHTVD
YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLTSSEWGWQIDPKGLRITLNTLYDRY
QKPLFIVENGLGAVDKVEEDGTIQDDYRINYLRDHLIEAREAIADGVELIGYTSWGPIDL
VSASTAEMKKRYGYIYVDRDNDGNGTLNRIKKKSFSWYQEVIATNGESL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaaatacaaaacgatttccagaaggatttttatggggcggcgcggttgctgcc
aaccaagttgagggtgcttataacgagggcggtaagggactttcgacagctgacgtatca
ccgaacggcatcatgtctccatttgatgaatcgatgacttctataaatctgtatcatacc
ggaattgatttttaccatcgttataaagaggacatcgccttgtttgcggaaatgggtttc
aaggcgttccgtacatctattgcgtggacaagaatttttccaaatggtgatgaagaggaa
ccaaatgaagaaggcctcaaattttatgataatctgtttgatgaactgttaaagcatcag
attgagcctgtcgtaaccatctcacattatgaaatgccgctcggtttagtgaaacattat
ggcggctggaagaatcgcaaagtcatagagttctatgaacgctatgccaaaaccgttttt
aaacgctatcaacgcaaagtgaagtattggatgacgttcaatgaaattaacgtggtcctc
catgcgccgtttacaggcggcggtcttgtctttggagaaggagaaaacaaattaaacgca
atgtaccaggcggcacaccaccagtttgtggccagtgctcttgccgtcaaagcgggtcac
gagatcatccctgattcgaaaatcggctgtatgatagcggcaaccacaacatatccgatg
acatcaaagccggaggatgttttcgcagcactggagaatgagcgcaaaacacttttcttc
tcagatgtgcaggcaagaggcgcatacccgggatatatgaaacgctatctggcagaaaac
aatattacaattgaaatggctgaaggcgatgaagagattttgaaagaacatacggtagat
tacatcggattcagctactacatgtcgatggcggcgagcactgatccggaagagcttgca
aaatcagggggcaacctgctgggcggagttaaaaacccttacctgacatcatcagaatgg
ggctggcagattgatccgaaaggcttgcgcatcacgcttaacaccttatatgaccgttat
cagaagccgctgttcatcgttgaaaacggcctgggcgctgtagacaaagttgaggaagat
ggcacgattcaggacgattacagaatcaattatctgcgtgaccatttaattgaagcgcgt
gaagccattgcggatggcgttgaattaatcggatacacatcatgggggccaattgacctt
gtcagtgcctccactgcggaaatgaaaaaacgttacggctacatttatgttgatcgggac
aatgatggaaacggaacattaaaccgcatcaagaaaaaaagcttcagctggtatcaagag
gtcatcgccactaacggagagagtctctga

DBGET integrated database retrieval system