KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_20025Help
Entry
BSUW23_20025      CDS       T01302                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase class 3
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSUW23_20025 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_20025 (fbp)
   00030 Pentose phosphate pathway
    BSUW23_20025 (fbp)
   00051 Fructose and mannose metabolism
    BSUW23_20025 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BSUW23_20025 (fbp)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BSUW23_20025 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3945475..3947400
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKPALNDWYKETINRMIKLV
SYCSSKYTRSKLRKALPAQFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITG
LAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKADDNRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDKNEITLHGKTYQLENTCFATINP
EQPDQLLEEEAEVIDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIEDKPYAGRELLDVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacttagatttactcgcacaaaaatacgattgtgaagaaaaagtggta
acggaaatcattaatttgaaagcgatactgaacctgccaaaaggcaccgagcattttgtc
agtgatttgcatggggagtatcaggcattccagcacgtgctgcgtaatggttcgggacga
gtaaaagagaagatacgcgacatcttcagcggtgtcatttacgatagagaaattgatgaa
ttagcagcactggtctattatccggaagacaaactgaagttaatcaaacatgactttgat
gcgaaaccagcattaaacgattggtataaagaaacgattaaccgaatgattaagctcgtt
tcttattgctcctccaagtatacccgctccaaactgcgcaaagcactgcctgcccagttt
gcttatattacagaggagttgctatacaaaacagaacaagctggcaacaaggagcaatat
tactctgaaatcattgatcagatcattgaacttggccaagccgataagctgatcactggc
cttgcttacagcgttcagcgattggtggtcgaccatctgcatgtggtcggcgatatttac
gaccgcggaccgcagccggataggattatggaagaactgatcaactatcattctgtcgat
attcagtggggaaatcacgatgtcctttggatcggcgcctactccggctccaaagtatgc
ctagccaatattatccgcatctgtgcccgctatgacaatctggatattattgaagacgtg
tacggcatcaatttaagaccgctgctgaacctggccgaaaaatattatgacgataatcca
gcattccgtccaaaagcagacgacaacaggcctgaggatgagattaagcaaatcacaaaa
atccatcaagcgattgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaatatggaggaacggctgttattagagaaaatagattacgacaaaaacgaa
atcacgctgcacggaaaaacatatcagctggaaaacacctgctttgcgacaattaatccg
gaacagccagaccagctattagaagaagaagcagaggtcatagacaagctgctattttct
gtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgctaattcacggctgtattcctgtcgatgaaaacggc
aatatggaaacgatgatgattgaagataaaccgtatgcgggccgtgagctgctcgatgta
tttgaacggttcttgcgagaagcctttgcccacccggaagaaaccgatgacctagcgaca
gatatggcttggtatttatggacaggcgaatactcctccctcttcggaaaacgcgccatg
acaacatttgagcgctatttcatcaaagagaaggaaacgcataaagaaaagaaaaatccg
tattattatttacgcgaagacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcatggccatatcattaacggccatacacccgtaaaagaaatcgaaggagaa
gacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacgctgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggcagaagtcctaagcactggaaccgacgtctta
acggtgaaacgattagtggacaaagagcttgagcggaagaaagtgaaggaaacgaatgtg
ggtgaggaattgttgcaggaagttgcgattttggagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system