KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_20115Help
Entry
BSUW23_20115      CDS       T01302                                 

Gene name
argI
Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSUW23_20115 (argI)
  Amino acid metabolism
   00220 Arginine biosynthesis
    BSUW23_20115 (argI)
   00330 Arginine and proline metabolism
    BSUW23_20115 (argI)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BSUW23_20115 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3964263..3965153)
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPISREKIKND
EELKNLNSVLAGNEKLAQKVNTVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
QYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHENKTGQTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtggacatgggaccaagtgccatccggtatgcccatctaattgagaggctgtcagacatg
ggttatacggttgaagatctcggtgacattccgatcagccgtgaaaagatcaaaaacgat
gaagaactgaaaaacctaaattccgtactggcaggaaacgaaaagctcgctcaaaaggtg
aacaccgtaattgaagagaaaaaattcccacttgtcctgggcggcgaccacagtattgcg
atcggcacgctggcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgacctgaatacacttgaaacatcaccttcaggcaatattcacggcatgccg
cttgccgtcagcctcggcatcggccatgagtcactggttaaccttgaaggctacgcccct
aaaatcaaaccggaaaacgtcgtcattatcggcgctcggtcacttgatgaaggagagcgc
caatatattaaggaaagcggcatgaaggtgtacacgatgcacgaaatcgaccgtctcggc
atgaccaaggtgatcgaagaaacccttgattatttatcagcatgtgacggcgtccatctc
agccttgatctggacggacttgatccaaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccacctggctatggaaatgctgtatgacgcaggcatc
atcacctcagctgaattcgttgaggtcaacccgattcttgatcacgaaaacaagactggc
caaacagcagtagagctcgtagaatctctgctagggaaaaagttgctgtaa

DBGET integrated database retrieval system