KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0019Help
Entry
GYO_0019          CDS       T01635                                 

Definition
(GenBank) Dck
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00230  Purine metabolism
bst00240  Pyrimidine metabolism
bst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GYO_0019
   00240 Pyrimidine metabolism
    GYO_0019
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GYO_0019
    2.7.1.76  2'-deoxyadenosine kinase
     GYO_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 SKI AAA_33 TsaE Cytidylate_kin2 ABC_tran AAA_15 AAA_17 RsgA_GTPase AAA_22 Cytidylate_kin AAA AAA_16 RNA_helicase AAA_25 MMR_HSR1 AAA_29 GTP_EFTU PRK AAA_14 ParA AAA_5
Motif
Other DBs
NCBI-ProteinID: AEP84790
UniProt: G4NT11
Position
complement(22569..23222)
Genome map
AA seq 217 aa AA seqDB search
MKEHHIPKNSIITVAGTVGVGKSTLTKALAKRLGFKTSLEEVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKIDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENILNRIEERGREMELQTSRSYWEEMHTRYENWVSGFNS
CPVLKLRIEDYDLLNDESSIENIVDQIASVIHENQKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacatcatatccctaagaattcaattatcacagtagcaggaacagtaggtgtc
ggaaaatcgactttaacaaaagctttggctaaaaggcttggatttaaaacctctctggag
gaagtcgatcataatccatacttagaaaagttctatcatgattttgaacgttggagcttt
cacctgcaaatctatttcttagctgaacgattcaaagaacagaaaacgatttttgaagcc
ggcggaggatttgtacaggatcgttcaatttatgaagacacaggaatttttgcaaaaatg
catgctgacaaagggacaatgtcaaagattgattataaaacttacacaagccttttcgaa
gcaatggtcatgacaccgtatttcccacacccagatgtattgatctatttagaaggagat
ctggagaacattttaaaccggattgaagaacgaggccgtgaaatggagcttcagacaagc
aggtcttattgggaagaaatgcatacacgctatgaaaactgggtaagcggttttaattcc
tgccctgttttaaagctccgtattgaggattatgatctgctgaatgacgaaagctcgatt
gaaaatattgtagatcaaatcgcttcagttattcatgaaaatcaaaaaaagtga

DBGET integrated database retrieval system