KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0026Help
Entry
GYO_0026          CDS       T01635                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bst03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28940..29536
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagatgtggta
ttagattttgcgaaagcattagtaaatgcgaaacgcaacctgacatattgttcagtttgc
gggcatattacagatcaggacccttgctatatatgtgaagatacacgcagggataagtcc
gttatctgtgttgtgcaagaccctaaggatgttatcgctatggagaaaatgaaggaatac
aacggacagtatcacgttcttcacggcgccatttctccaatggacggcatcggaccagag
gatattaaaataccagaattgttaaaacgattacaggatgatcaagtgacagaagtgatt
ctcgcaactaaccctaatatagaaggggaagcaacggcgatgtatatatcaaggctcctg
aagccgtctggtattaagctctcccgtattgcccacggactgcccgtcggcggcgatttg
gaatatgctgatgaggtcactctttctaaagcacttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system