KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0091Help
Entry
GYO_0091          CDS       T01635                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bst00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85890..86666
Genome map
AA seq 258 aa AA seqDB search
MGILNVTPDSFSDGGKYDSLDKALLHAKEMIDDGAHIIDIGGESTRPGAEYVSEDEEMSR
VIPVIERITKELGVPISVDTYKASVADEAVKAGASIINDIWGAKHDPKMASVAAEHNVPI
VLMHNRPERNYNDLLPDMLSDLMESVKIAVEAGVEERNIILDPGIGFAKTYHDNLAVMNK
LEILSGLGYPVLLATSRKRFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQIA
RMAKMMDAMLNKGGVHHG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggaattttaaacgtaacgcctgactctttctcggacggcggaaaatatgacagcttg
gacaaggcactcctgcacgcgaaagagatgatcgatgacggtgcccatatcattgacatc
ggaggagaatcgacaaggcctggcgctgaatatgtctcagaggatgaggagatgtccaga
gtgattccggtaattgagcggatcacaaaagaactgggcgtgccgatttctgtagatacg
tacaaggcttctgtcgcagatgaagctgttaaagcaggcgcatccatcatcaatgatatt
tggggagcgaaacatgatccgaagatggcttccgttgcagcagaacacaatgttccgatt
gttctcatgcataaccgccctgagagaaattacaatgacttattaccggatatgctgtcg
gacttaatggagagtgtaaaaatcgctgttgaggccggagtagaggaaaggaacattatc
cttgatccaggtatcggtttcgcgaaaacctatcatgataacttggcagtgatgaacaaa
ctcgagattttgagcggactggggtatccggttcttctggcaacctcccgaaaaagattc
atcggacgtgttctggatcttccgcctgaggagcgggctgagggcacaggtgcgaccgtg
tgtctcggcattcaaaaaggctgtgacattgtcagggtccatgacgttaaacaaattgcc
agaatggcgaaaatgatggacgcgatgctgaataagggaggggtgcaccatggataa

DBGET integrated database retrieval system