KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0093Help
Entry
GYO_0093          CDS       T01635                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bst00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87018..87521
Genome map
AA seq 167 aa AA seqDB search
MNNIAYIALGSNIGDRETYLRQAVALLHQHDAVTVTKVSSIYETDPVGYEDQDEFLNMAV
EIKTSLNPFELLELTQHIENELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMY
ERLFVLAPLAEICPQVEKEATSAETDQEGVRVWKQKSGVDEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatagcttatatcgcacttggatcaaacattggagatagagaaacatattta
aggcaagcagtggcattgctgcaccagcatgatgcggtgacagtcactaaagtgtcgtcc
atttacgaaactgacccggtcggatacgaagaccaagatgaatttttgaatatggctgtt
gaaatcaagacgtcgctgaacccttttgaactccttgagctgacgcagcatatagaaaat
gaattaggaagaacaagggaagtaagatggggaccgcggacggcagaccttgacattttg
ctgtttaatcgtgaaaatattgaaacagagcaactaattgttccgcatccgagaatgtat
gagcgtttgtttgtccttgcgccgcttgcggagatttgcccgcaggttgaaaaagaggca
acaagtgcggaaacagaccaagaaggtgtaagagtatggaagcagaaatctggggtagac
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system