KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0358Help
Entry
GYO_0358          CDS       T01635                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GYO_0358
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    GYO_0358
Enzymes [BR:bst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GYO_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(301200..303128)
Genome map
AA seq 642 aa AA seqDB search
MKPVFPLILSAVLFLSCFFGTSQTKAASSSGSADAKQIVNHMTLDEKLGQMLMPDFRNWQ
KEGESSPQALTEMNEEVAGLIKKYQFGGVILFAENVKTTRQTVQLTDAYQKASPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGTLIGKELSALGINTDFSPVMDIN
NNPDNPVIGVRSFSSNRELTARLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHSQERLREVELYPFQRAIDDGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKV
MTGLLRQEMGFNGVIITDALNMKAIADHFGQEEAVVMAIKAGVDIALMPASVTSLKEEQK
YARVIQALKEAVKNGDIPEHQINKSVERIISLKIKRGMYPDRNDDSIKEKIAKAQKIVGS
KRHLKAEKKIAEKAVTVLKNEQHTLPFKPKKDSRILIVAPYEEQTASIEQTIRDLVKRKK
IKPVSLSKMNFANQVFNAEHEKQVKEADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQAKPKGTLPVDIPSVTKPGDILYPYGYGLNIKTGKPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtatttccgcttatcctttcagccgttctctttctttcatgtttttttggc
accagtcagacaaaagccgcttcatccagcggctcagccgacgccaagcagattgtcaat
cacatgacgttagatgaaaaactcggccagatgctgatgccagatttcagaaattggcaa
aaggaaggcgagtcctctccgcaagcccttacagaaatgaatgaggaagtcgccggcctt
atcaagaagtatcaattcggcggcgtcatcctttttgcagaaaatgtaaaaacaacgagg
caaactgtacagctgacagacgcttaccaaaaggcgagccctaaaatcccgctcatgctg
agtattgatcaggaaggcggcatcgtaacgagattaggggagggcactaatttcccaggg
aatatggcgctaggcgcagccagaagcagaatcaatgcctatcagaccggcacccttatt
ggaaaggagctctctgccttaggcattaatacagattttagccctgtaatggacattaat
aataatcctgataatccggtaatcggcgtacggtcattcagctctaatcgagaactgaca
gcacgactcggtttatatacgatgaagggtttgcagcggcaagatatcgcctctgccctc
aaacatttcccgggacatggagacactgacgttgacagccattacggattgccgcttgtt
tcccatagccaagaacggcttcgtgaggtcgagctctatccttttcaaagagcaatcgat
gacggtgctgatatggtgatgacagcacacgttcaatttcctgcctttgacgacaccaca
tacaaaagcaaactcgatggatcggacattctggtgccggctacactctcgaaaaaagtg
atgacaggtcttcttcgtcaggaaatgggctttaatggcgtcatcattactgacgctctc
aatatgaaagcaatcgcagatcatttcggccaggaagaggctgtagtcatggctataaaa
gccggtgtcgatattgcattaatgcctgcctcagttacttctctgaaagaagaacagaaa
tacgcacgtgttattcaagctttaaaagaagcagtgaaaaacggagacattcctgaacat
caaatcaacaaatcggttgaaagaatcatttccctgaaaataaaacgcggtatgtatcca
gatcgaaacgacgacagcataaaagaaaaaatagccaaagcccagaaaatcgtaggaagc
aagcgtcacctgaaagcggagaaaaaaatagctgaaaaagcagtgacggtattaaaaaat
gaacagcacaccttgccgttcaagcctaaaaaagacagccgaatcttaattgtcgcgccc
tacgaagaacaaactgcttcaattgaacaaaccattcgcgatctcgtcaagcgaaagaaa
atcaaacccgtgtccctcagcaaaatgaattttgccaaccaagtatttaatgccgagcat
gaaaaacaagtaaaagaggctgattatatcattaccggctcctatgtcgtgaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgataccatatcagattcaagcaagtgggccacc
gtatttccgagagctgtgatgaaagccgcactgcagcacaacaaaccatttgtcttaatg
agccttcgcaacccatatgatgccgccaattttgaagaagctaaggcactcattgctgtc
tatggctttaaaggatacgcgaatggccgttatctacaaccaaatattcccgccggagtt
atggcgatattcggccaggcaaaacctaaaggcacacttccagttgacattccgtcagtc
acgaaaccgggagacatcctttatccatatggctacggattaaatatcaaaacgggaaaa
ccgctctaa

DBGET integrated database retrieval system