KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0554Help
Entry
GYO_0554          CDS       T01635                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_0554
Enzymes [BR:bst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     GYO_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485885..487318
Genome map
AA seq 477 aa AA seqDB search
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGDIAVDH
YHRFKEDVALMAEMGLKAYRFSVSWPRIFPKGKGEINEAGLAFYDNLIDELLSHNIEPVL
TLYHWDLPQALMDEYSGFESRNIIEDFNNYCVTLYKRFGDRVKYWVTLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPDGKIGPSFAYSPAYPLSSHPEDI
LAFENAEEFMNNWWLDMYCWGTYPQIPFRYLEKQGWAPTIEAGDVELLAKGKPDFVGVNY
YQTITYERNPLNGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLR
IGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLHSHLEQCRQAISDGVDLIG
YCSWSFTDLLSWLNGYQKRYGFVYVHRDEENTHDLKRLKKKSFYWYQDVIKTNGESL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatccaccagcatccagaatcttttccgaaacattttttgtggggctctgcttcagca
gcgtaccagattgaaggcgcttggaacgaagatggcaaaggtccttctgtatgggacgta
tttacgaaaataccgggcaaaacgtttaaagggaccaatggcgatattgcggttgaccat
tatcaccgttttaaagaagatgtcgctttgatggctgagatgggcttaaaagcgtatcga
ttttccgtcagctggccgcggatttttccaaaaggaaaaggggagatcaatgaagcaggc
ctagctttttacgataacctgattgacgagttgctttctcataacatcgagccggttctg
actttatatcattgggatttgcctcaggcgcttatggacgagtacagcggttttgaatca
agaaatatcatagaggattttaataactactgtgttactctttataaacgttttggagac
agagtgaaatattgggttacgttaaacgaacagaactacaattttaatcacggctttatt
acagccatgcacccgcctggagtgaaagacagaaaacgattttacgaagcaaaccatatt
gcgtttctggctaatgcgaaagccattgaatcttttagagaatatgtgcctgatggcaaa
atcggtccaagctttgcttattctccggcttaccctttatccagccatccagaggatata
ctggcatttgaaaacgctgaagaatttatgaacaattggtggctggacatgtattgctgg
ggaacctacccgcaaattcctttccgctatttagaaaaacaaggctgggcgccgacaatc
gaagcaggagatgtggagctgcttgccaaaggaaagcctgattttgtaggtgtcaattat
tatcagaccatcacctacgaacgaaatccgcttaatggtgtgtcggaagggaaaatgaat
acgacaggccaaaaggggaccaaccaggaaacagggatacccggagtgtttaaaacgaaa
aaaaatccgcacctgacaacgagcaactgggattggacaattgacccaatcggattgcgt
atcggtcttcgccgaattacaagccgctatcagcttccagtgtttatcacagagaatggt
ttgggtgaatttgataaagttgaggatggcactgtacaggatgattatcgaattgattat
ttgcattcgcatcttgagcaatgcagacaggccatcagcgacggtgtcgatttgatcggc
tattgcagctggtcgtttactgatctattaagctggctgaatggctaccaaaaaagatac
ggattcgtttatgttcatcgcgatgaagaaaatacacatgatttaaaacgcttgaagaaa
aaaagcttttattggtatcaggatgtaatcaagacgaacggagaaagtttataa

DBGET integrated database retrieval system