KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0651Help
Entry
GYO_0651          CDS       T01635                                 

Definition
(GenBank) putative nudix-family hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Enzymes [BR:bst01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     GYO_0651
DNA repair and recombination proteins [BR:bst03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    GYO_0651
 Prokaryotic Type
    GYO_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AEP85358
UniProt: G4NTZ8
Position
603932..604327
Genome map
AA seq 131 aa AA seqDB search
MYTQGAFVIVLNNNQQILLVKRKDVPLWDLPGGTIDPGETAEAAAVREVLEETGYSAVLS
AKIGVYQRPKFQDEQHVFAGHITGGQAIANGMETAELKWFSPQRLPLFMVPNRKRQIKDF
VNGALDITITL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtatacacaaggtgcatttgtgatcgtgttgaacaacaatcagcagattctgctggtt
aaacgaaaggatgtccctttatgggatctgccgggcggcacgatcgatcccggggaaacg
gctgaggcagcggcagttcgggaggtattggaagaaacgggatacagcgcagtgctttct
gcgaaaataggtgtctatcaaaggccaaagtttcaagatgagcagcatgtatttgccgga
cacataacaggcggacaagcgatagcgaacgggatggagacagcggaattgaagtggttt
tctccgcaacgtttgccgctttttatggtgccgaaccgaaaaaggcaaatcaaagatttc
gtgaatggcgctctagatataaccatcaccctctag

DBGET integrated database retrieval system