KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0653Help
Entry
GYO_0653          CDS       T01635                                 

Definition
(GenBank) hypothetical protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEP85360
UniProt: G4NU00
Position
606272..606472
Genome map
AA seq 66 aa AA seqDB search
MFESIKLVVYLLGSTGMIYAACHDFRHAQNGQKDKCIFFQSKKISAFVLLCFVCLFFSNL
AEFSSL
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatccataaaattagtggtgtacttattaggatcaacaggaatgatttatgca
gcctgtcatgattttcgccatgctcaaaacggacaaaaggacaaatgcatcttctttcaa
agcaaaaagatcagcgcatttgtccttttatgtttcgtatgtttattcttttcaaatctt
gcagagttctcttctttataa

DBGET integrated database retrieval system