KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0654Help
Entry
GYO_0654          CDS       T01635                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4064 DUF4231 PGG
Motif
Other DBs
NCBI-ProteinID: AEP85361
UniProt: G4NU01
Position
complement(606475..606771)
Genome map
AA seq 98 aa AA seqDB search
MIEEKIGVLMMSVFILFYLWIVPIVIGILCSVVAYKSKGKMRVAPGIAMIVLSIISLITA
FTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagaaaaaatcggagttttgatgatgtcagtatttattctgttttatttgtgg
attgttcctattgtaatcggaattttatgttctgttgttgcctataaatccaaaggaaaa
atgagagtcgcgcctggcattgccatgatcgtgctcagtatcatttccttgatcaccgcg
tttacggccggacacacgaattttcacgtgtttatcggcggaatgtttttattcggcacc
ttcttggttggttctgcttttcctttctttttcgggcttaagaaaaaagagaaataa

DBGET integrated database retrieval system