KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0663Help
Entry
GYO_0663          CDS       T01635                                 

Definition
(GenBank) C4-dicarboxylate-binding periplasmic protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctP COesterase Rota_NS53 DUF3581 Colicin-DNase
Motif
Other DBs
NCBI-ProteinID: AEP85370
UniProt: G4NU10
Position
complement(612347..613399)
Genome map
AA seq 350 aa AA seqDB search
MKSFLACLALMIAGIATALFIGFHDHTGSEEIVYDDDQEGLQDQIVFKFSHVVAENTPKG
LAANKFAELVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQFIAPSTSKLGMLSPEW
GVLDLPYAFTNYDAVKKGLNGSIGTQLFDSLKKNQLKGLAYWTNGFKQITTNQGPVKDPD
DLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNVVDGEENTISNIYSKKFYN
VQDYLTISSHGYLGYAVMTDEHFWNAQTSETRRILTEAMKETTEWNETYAEEMNKEQLEE
IQKHSSIKIYELSDKEKKEWMKRLDPVYRQYEPIFGRKLIQELLELREDS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtttccttgcatgtctcgcactgatgatcgccggaattgcaaccgctttattt
atcggattccatgatcataccggcagtgaagagattgtttatgatgacgaccaggaaggc
ttacaggatcaaatcgtgtttaaattcagccatgtggttgccgaaaatacgccgaaaggg
ctggccgccaataaattcgccgagctggtgaacgaaaaatcaggcggaaaaataaaaatt
gaagtgttcccgaatggtagcctgtattcggacatcgaagaaattgaagcattgcaaaac
ggcgacgttcaatttatcgccccctccacatcgaagctcggcatgctctcgcctgaatgg
ggcgtgctggatcttccgtatgcatttacaaattacgatgctgtcaaaaaagggctgaac
ggcagcatcggcacacagctgtttgattctctaaagaaaaatcaattaaaaggactcgcc
tattggacaaacggctttaagcaaatcacgacaaatcaaggaccggtcaaagacccggat
gatttaaaaggacaagatctccgcattatgcaaagcgatgtgatagaggatcagttcaag
ctgcttggcgcaacacctcatcaggaatccttcaattctacctttcagctgttagaaaac
aatgtagtcgatggcgaagaaaatacaatctcaaacatctattctaaaaaattttataat
gttcaggactatttgacaataagcagccacggttatctcggttacgctgtcatgactgat
gagcatttctggaacgcgcaaacatcggaaacaaggcgcattttgactgaagcgatgaag
gaaacgacggagtggaacgaaacgtatgccgaagaaatgaacaaggagcagctggaagaa
atccaaaaacattcatctattaaaatctacgagctgtcagataaagagaaaaaagaatgg
atgaagcgccttgatcctgtttaccggcagtacgagcccatcttcggccggaagctgata
caggagcttttagagctgcgagaggattcgtaa

DBGET integrated database retrieval system