KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0693Help
Entry
GYO_0693          CDS       T01635                                 

Gene name
rsbW
Definition
(GenBank) anti-sigma B factor
  KO
K04757  serine/threonine-protein kinase RsbW [EC:2.7.11.1]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GYO_0693 (rsbW)
Protein kinases [BR:bst01001]
 Serine/threonine kinases: Other
  Bacterial family
   GYO_0693 (rsbW)
Transcription machinery [BR:bst03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     GYO_0693 (rsbW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_2 HATPase_c
Motif
Other DBs
NCBI-ProteinID: AEP85399
UniProt: G4NW59
Position
639173..639655
Genome map
AA seq 160 aa AA seqDB search
MKNNADYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYK
EDKNGEVSIRFGVFEDRLEVIVADEGDSFDFDQKQQDLGPYTPSHTVDQLSEGGLGLYLM
ETLMDEVRVQNHSGVTVAMTKYLNGERVDHDTTIKNYETN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataacgcagattacatcgaaatgaaagtgccggcccaacctgaatatgtaggg
attataaggctgacactgtcaggcgtcgcgagcagaatgggctatacgtacgatgaaatt
gaagatctgaaaatcgcagtcagtgaagcgtgtacaaatgcagttcagcacgcttacaaa
gaagataaaaatggggaagtgtcaatccgattcggtgtgttcgaagaccgtttagaggtc
attgtggcggatgaaggagacagctttgatttcgatcaaaagcagcaggatctagggccg
tacacaccttcgcacacagttgatcaattatcagaaggagggctcggtctatatttaatg
gaaacgctcatggatgaagtcagagtgcaaaaccactccggcgtcaccgtagcgatgaca
aagtatttaaatggggagcgagttgatcatgacacaaccatcaaaaactacgaaactaac
taa

DBGET integrated database retrieval system