KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0698Help
Entry
GYO_0698          CDS       T01635                                 

Definition
(GenBank) metallopeptidase, SprT family
  KO
K03095  SprT-like protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SprT-like Zn_ribbon_SprT Zn-ribbon_8 C1_2 DUF3362 zf-C3HC4_3 DUF4503 DZR NCD3G TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AEP85404
UniProt: G4NW64
Position
643578..644030
Genome map
AA seq 150 aa AA seqDB search
MDNKELQKLTEDISETYFNKPFRHQALFNDRLKTTGGRYLLTSHNIELNRKYLIEHGREE
LIGIIKHELCHYHLHLEGKGYKHRDRDFRVLLQQVNAPRFCTPLKKKTENKKTYMYICTA
CGQQYIKKRAMNPDRYRCGKCRGKIKRIFS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggataacaaagagcttcaaaagctgacagaggatatttccgaaacgtattttaacaag
ccgttccgccatcaggcgctttttaatgacaggcttaaaaccacgggcggaaggtacctg
ttaacctcccataacattgaattgaacagaaaatatctgattgaacatggcagggaggaa
ctaatcggcatcatcaagcacgagctctgccattatcatcttcaccttgaaggaaagggg
tacaagcacagagacagagattttcgagtgttgctgcagcaggtcaacgcgccaaggttc
tgtacaccccttaagaaaaaaacagaaaacaaaaaaacttatatgtatatctgtacggcg
tgcggccaacagtatataaagaagcgtgccatgaatcctgacagatacagatgcggaaaa
tgccgcggaaaaataaaaagaattttttcgtaa

DBGET integrated database retrieval system