KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0721Help
Entry
GYO_0721          CDS       T01635                                 

Definition
(GenBank) YddR
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-ProteinID: AEP85420
UniProt: G4NW80
Position
658697..659461
Genome map
AA seq 254 aa AA seqDB search
MNITQIRNATIVVKYANKKFLIDPMLAEKGTYATFPETIRQDLFNPLVSLPTSIDNILDG
VDAVIVTHLHLDHFDDVAKNVLPKNIKMFVQNEADAKEVKASGFKNVEVLQQDTVFEGIQ
LVKTKGEHGRGEELLNLMGDVCGLVFKHPSEKVLYVAGDTVWYDAIEDEIHTHQPEIIVV
NGGDNKRLDLGSLIMGKEDIYEVHKAAPHAKIISVHMEAVNHWTLSREELKNFSKEKGFS
SNILVPEDGESYTF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatattacacaaattcgaaatgcaacaattgttgtaaaatacgcaaataaaaaattt
ttaatagatcctatgttagcagagaaaggtacgtacgctactttccctgaaacgatcaga
caagatctatttaatcctttggtgagtttgccaacatcaattgataacattctggatggc
gtagatgcagtaattgttactcatctacatctagatcactttgatgatgtggcaaaaaac
gtattgccaaaaaacatcaaaatgtttgttcaaaatgaagcagatgcaaaagaagtaaaa
gcaagtggtttcaaaaatgtagaagtactgcaacaagacactgtttttgaagggatccaa
ttagtaaaaacaaaaggtgaacatggcagaggagaagagttattaaacttaatgggtgat
gtttgtggattagtattcaagcacccaagtgaaaaagttttatatgtagctggggataca
gtttggtatgatgctatcgaagacgagattcatacacatcaaccagaaatcattgtggtt
aatggtggagacaataaaagattagatttaggttcactcatcatgggaaaagaagacatc
tatgaagttcacaaggctgctcctcatgctaagattatatctgttcatatggaagctgtt
aaccattggacactatctagagaagaattaaaaaactttagtaaagaaaaaggattctca
agtaatattttagttccagaagatggcgagtcttacacattttaa

DBGET integrated database retrieval system