KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0741Help
Entry
GYO_0741          CDS       T01635                                 

Definition
(GenBank) hypothetical protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEP85438
UniProt: G4NW98
Position
complement(675490..675615)
Genome map
AA seq 41 aa AA seqDB search
MQFYFSLILLVNSVFFAYFHYPSNINSFTLPLDNLTLFSPN
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
atgcaattctatttttcattaattcttctagtgaattctgtatttttcgcttattttcat
tatccaagcaatatcaattcgtttacattgcctcttgacaacctcactctcttttcgcca
aattaa

DBGET integrated database retrieval system