KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0746Help
Entry
GYO_0746          CDS       T01635                                 

Definition
(GenBank) carbonyl reductase [NADPH] 1
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase NmrA RmlD_sub_bind Spheroidin
Motif
Other DBs
NCBI-ProteinID: AEP85443
UniProt: G4NWA3
Position
complement(679802..680509)
Genome map
AA seq 235 aa AA seqDB search
MSQDKQVVLVTGGNRGIGYELAKQLGVNGFKVILASRDPVLGPEAAQKLRASGLDVSFVP
IDVEDQESIRQAVITVNEQYGRLDVLINNAGVYLDKNEKLLYMDPSILEKTMAINFFGAY
HVMRSFIPLMEKQGYGRIINVSSEYGAVSEMSDQGVGAYKLSKLALNGLTRLAAAEIKGD
IKINAVDPGWVSTDMGGPSAPRTPKEAAESILWLATTGPDGPNGEFFRDRERIDW
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggacaaacaagttgtacttgtcaccggcggaaatcgcggaattggatatgaa
ctggccaagcaattaggtgtgaatgggtttaaggtcattctggcaagccgagatccagtg
ttaggtcctgaagcggcacaaaaacttagggcttcaggtcttgatgtttcatttgtgccg
attgatgtagaagatcaagaaagcatccggcaagctgtgattacagtaaatgagcaatat
ggaagattagatgtgttaatcaataatgcaggtgtgtatttagataagaatgaaaaatta
ttgtatatggacccttccatcctagagaaaacgatggcaattaatttcttcggcgcttat
catgtcatgcggtcctttattcctctcatggaaaaacagggctacgggagaattattaat
gtttcttcagaatatggagctgtgagcgaaatgtctgaccaaggagtcggggcttataag
ttatccaaacttgcactaaatggattgacacgattggccgctgcagaaatcaagggcgat
atcaaaataaacgcggtcgatccgggatgggtaagtacagatatgggtgggccatctgct
ccgagaacgcctaaggaagctgccgagtctatcctttggttagcgacgactgggccagat
ggacctaacggggaattcttcagagacagagaacgaattgattggtaa

DBGET integrated database retrieval system