KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0757Help
Entry
GYO_0757          CDS       T01635                                 

Definition
(GenBank) cinnamoyl ester hydrolase
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_34
Motif
Other DBs
NCBI-ProteinID: AEP85454
UniProt: G4NWB4
Position
complement(689392..689721)
Genome map
AA seq 109 aa AA seqDB search
METTLDIIGGKWKGILLYHLIDGKKRFNEFRRLYPKITQRMLTLQLRELERDGVIHREVY
KQVPPKVEYSLTEFGRTLEPVILHMKDWGEKYRDRINKIETTRKAEEEI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
gtggagacaacattagatatcatcgggggtaagtggaaaggcattctcctttatcatctc
attgacggtaaaaagaggtttaatgaattccgaagattatatcctaaaattacccaacgc
atgcttactctacaattaagggaattggagcgggatggcgtgattcaccgcgaggtttat
aaacaggtccctccaaaagtggaatactctttaaccgagtttggaagaacgttagaacct
gttatcctgcacatgaaagactggggagaaaagtacagagacagaatcaataaaattgaa
acaacacgtaaagctgaagaagaaatctaa

DBGET integrated database retrieval system