KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0758Help
Entry
GYO_0758          CDS       T01635                                 

Definition
(GenBank) general stress protein 14
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_2 FMN_red DUF4965
Motif
Other DBs
NCBI-ProteinID: AEP85455
UniProt: G4NWB5
Position
689861..690484
Genome map
AA seq 207 aa AA seqDB search
MIHIKGKKGMDDMKTLVLVVHPNFESSRINKKWKEAVLSEPDVTVHDLYEKYRNQPIDVE
FEQQQLLAHDRIVFQFPLYWYSSPQLLKQWFDEVFTFGWAHGPGGTKLNEKEWVTAMSIG
SPEHSYQAGGYNLFSISELTKPFQASANLVGMTYLPSFAEYRANRISDQEIAESANRYVK
HITNIELNPKVRLQRYLKQLESVDLKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattcacatcaaaggaaagaaaggaatggatgatatgaaaacattagtactcgttgta
catccgaacttcgaatcctctcgtataaataaaaagtggaaagaagcggttttaagtgaa
ccggatgtaactgttcatgatctctatgaaaaatatcgcaatcaaccgattgatgtggaa
tttgaacaacagcagcttcttgcccatgaccgtattgtttttcagtttccgttatattgg
tacagcagtccccagctgttaaaacagtggtttgatgaagtgtttacttttggctgggct
catggccctggcggaacgaaattgaatgaaaaagagtgggtgactgccatgtccatcggt
tcacctgaacattcttatcaagccggcggatataacttattttcaataagcgaactgaca
aagccgttccaagcatctgccaatttagtaggcatgacttatctgccttcctttgctgaa
tatcgcgctaatcgaatcagtgaccaagaaatcgccgaaagtgcgaatcgctatgtaaag
catataacaaatatagaattaaaccctaaggttcgcctgcaaaggtatttaaagcaactg
gagagtgttgatttaaaatcatga

DBGET integrated database retrieval system