KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0762Help
Entry
GYO_0762          CDS       T01635                                 

Gene name
arsC
Definition
(GenBank) arsenate reductase
  KO
K03741  arsenate reductase [EC:1.20.4.1]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     GYO_0762 (arsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LMWPc
Motif
Other DBs
NCBI-ProteinID: AEP85459
UniProt: G4NWB9
Position
692482..692901
Genome map
AA seq 139 aa AA seqDB search
MSKKTIYFLCTGNSCRSQMAEGWGKKYLGDKWNVYSAGIEAHGLNPNAVKAMKEAGIDIS
NQTSDKIDPNILNNADLVITLCGDAADKCPMTPPNVKREHWGFDDPAKAQGTDEEKWAFF
QRVRDEIGDRLKQFAETGE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaaaacaatctactttttatgcaccggaaactcttgccgcagtcaaatggct
gaagggtgggggaaaaaataccttggtgataagtggaacgtgtacagcgcaggaatcgag
gctcatggattaaaccctaatgctgtcaaagcaatgaaagaagcggggattgatatttcc
aatcaaacttcagataaaattgatccgaacattttaaacaatgctgatttagttattact
ctctgtggtgatgcagctgacaagtgcccaatgacgccgccgaatgtaaaacgcgagcac
tggggatttgatgatccggcaaaagcacaaggaacagacgaagaaaaatgggcatttttc
caaagagtgcgtgatgaaattggagaccgcttaaaacagtttgctgaaactggggaataa

DBGET integrated database retrieval system