KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0767Help
Entry
GYO_0767          CDS       T01635                                 

Gene name
yclK
Definition
(GenBank) two-component sensor histidine kinase YclK
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 SpoVT_C Diacid_rec
Motif
Other DBs
NCBI-ProteinID: AEP85464
UniProt: G4NWC4
Position
complement(697289..698740)
Genome map
AA seq 483 aa AA seqDB search
MLRTIKGKFIIGFFLIFSLSFLVLNQTVKSVIRSSNEKIVTSDLIELKKNSIVYINQAFL
INHYKNNELYFDDMADEIVESLTHSTGSNVGVYSVDGNLLSSSNKTVFSQGIDEDLEKAI
NGKNAYHITYDRNKAQVFFSYPVVIDGAKVGILRFSKDFNLLYKQSGEILNIIFYIALAI
FVAAFLFSYILSRHITIPIVKLTEATSEVKKGKLDVDIHFPRKDEIGQLTINFNDMITRI
RDQISTIEKDRDRLKELNEQEKRFFDNMTHELKTPLTSIQGYAEIIKEKGESDPKFFNKG
MNHIVEESRRLHNLVIKLLEVSRETSKNRHSDRIDAGTILKDVCESMKFRAERYNKKIIC
EMDEDLYVYGQTNRLRQLFINLLDNAIKYSLSNSKIMIKAKAVGDQVLFIFKNPSDPYDD
TQYTKVFQPFYSINQKVTEEGSLGLGLSIVKTIVEEHQGTIKMFYKENHTIITIELAYMK
VEK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgttacggaccatcaagggtaaattcattattgggttttttctgattttctctctctct
ttccttgtgctcaatcaaacggtcaagagcgtcattaggtcaagtaatgaaaaaattgtg
acctcagatttaatagagttgaaaaaaaacagtattgtgtatatcaaccaagcgttttta
atcaatcattataaaaacaatgaactatacttcgacgatatggctgatgaaatagtggaa
agtttaactcattcaaccggaagcaatgtaggtgtttatagcgtggatggcaatttgttg
tcttcttctaataaaacggtgttttcgcaaggtattgatgaggacctagaaaaagcgatt
aacggaaaaaatgcttatcacatcacctatgatcgaaataaagcacaggtatttttctct
tatccagttgtcattgatggtgcaaaagttggcatattacgcttttctaaagattttaat
ctgctttacaaacaaagtggagagattttaaatattattttttatatcgcccttgcgata
tttgtggcggcgttccttttctcttatatactttccagacatatcacgataccaatcgtc
aagctgacagaggctacctcagaagtcaaaaaaggaaagctggatgtggatatccacttt
cctagaaaagatgaaattggccagcttactattaatttcaatgatatgattaccagaatt
cgagatcaaatttcaaccatcgaaaaagatcgggatcggttgaaggaacttaacgagcag
gaaaaacgtttttttgacaatatgacccatgagctgaaaacacctttgacttctattcaa
ggctatgcggaaatcataaaagaaaaaggggaatcagatccgaagttttttaataaagga
atgaatcatattgttgaagaaagccggcgtctgcacaatttggtcataaaacttcttgag
gtatctcgagaaacatctaaaaatcgtcattccgataggatcgatgcaggaacaattttg
aaagatgtatgcgaatctatgaaatttcgtgcagaacgatataacaaaaagatcatctgt
gaaatggacgaagacctctatgtgtatggccaaacgaatagactgcgccaactttttatt
aatcttctggacaatgcaatcaaatacagtttatcgaattcaaaaatcatgattaaggct
aaagctgttggagatcaggttctttttatattcaagaatccaagtgatccatatgatgac
acccaatacactaaagtgtttcagcctttttattcgattaaccaaaaggtcacggaagaa
ggaagtttaggcttgggtttaagcatagtgaaaacaattgttgaggaacatcagggaaca
atcaagatgttctacaaagaaaaccacactataatcacgattgaactagcttacatgaag
gttgagaaatga

DBGET integrated database retrieval system