KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0771Help
Entry
GYO_0771          CDS       T01635                                 

Definition
(GenBank) YdfE
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct Putative_PNPOx
Motif
Other DBs
NCBI-ProteinID: AEP85468
UniProt: G4NQZ9
Position
complement(702282..702905)
Genome map
AA seq 207 aa AA seqDB search
MDIEKQDTLHFKEIKPNIMYYGTSTFLLTTLNEDGTTNISPMSSSWALGNYIVLGVGLGG
KAIENLERHKECVINLPGPELWENVERISSYSGKKNIPPLKKELGFTYKKEKYESAGLTP
LQSKTVSPTRIKECPIHIEAEVKHIRFPEYEPSFAIVETQALHFHAEESIILNENHINPS
KWSPLIYNFRHYFGLGREIGKTFRSET
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttggacattgaaaaacaagatactcttcattttaaagaaatcaaaccaaacatcatgtat
tatggtacctctacatttcttcttaccacattgaatgaagatggaaccactaatatcagt
cctatgtcttcttcttgggctctcggaaactatattgtccttggagttggactaggagga
aaagccattgaaaatttggaaagacacaaagaatgtgtcataaacttgcctggcccggaa
ttatgggaaaacgttgaaagaatttcgtcttatagcggaaaaaagaatataccccctttg
aagaaagagctcgggtttacatataaaaaagaaaaatacgagtcagcaggcttaacacct
ttacaatcaaaaacagtttcaccaacacgcattaaagaatgccctattcacattgaagcc
gaagtcaaacatattcggttcccagaatatgagccatcatttgcgattgtagagacacag
gcactacattttcacgccgaggagagtatcatattgaacgaaaaccatatcaatccttca
aaatggagtccgctgatctataattttagacattattttggtttaggcagagaaatagga
aagacctttcgttcagaaacatga

DBGET integrated database retrieval system