KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0813Help
Entry
GYO_0813          CDS       T01635                                 

Definition
(GenBank) nucleotide binding protein ExpZ
  KO
K18231  macrolide transport system ATP-binding/permease protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bst00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    GYO_0813
Transporters [BR:bst02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Macrolide exporter
    GYO_0813
Antimicrobial resistance genes [BR:bst01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    GYO_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N ABC_tran_Xtn AAA_29 AAA_22 AAA_30 AAA_16 NB-ARC AAA_33 RsgA_GTPase NACHT AAA_28 AAA_18 ATP-synt_ab MMR_HSR1 AAA_15 AAA_14 cobW Roc TsaE AAA_24 AAA_23 KAP_NTPase AAA SbcCD_C Zeta_toxin Dynamin_N PduV-EutP T2SSE PRK IstB_IS21 ATPase_2 Tox-REase-5 Peptidase_M23 ArgK SRPRB Tfb4
Motif
Other DBs
NCBI-ProteinID: AEP85505
UniProt: G4NR36
Position
complement(730741..732369)
Genome map
AA seq 542 aa AA seqDB search
MKEIVTLTNVSYEVKDMTVFKNVNASIQQGDIIGIIGKNGAGKSTLLHLIHNDLTPAQGQ
ILRQELKMTLVEQETASYCFADQTPAEKKLLEKWRVPVRDFQQLSGGEKLKARLAKGLSE
DADLLLLDEPTNHLDKESLQFLIQQLKSYRGTVILVSHDRYFLDEAATKIWSLEAQTLIE
FKGNYSGYMKYREKKRLAQQREYEKQQKMVERIEAQMNELASWSEKAHAQSTKKEGFKEY
HRVKAKRTDAQVKSKQKRLEQELEKVKAEPVEPKYTVRFSIDTTKKTGKRFLEVQHVTKA
FGERTLFKNAHFTIQHGEKVAIIGPNGSGKTTLLKIILGQETAEGSVWVSPSANIGYLTQ
EVFDLPLEQTPEELFENETYKARGHVQSLMRHLGFTASQWTEPIKHMSMGERVKVKLMAY
ILEEKDVLILDEPTNHLDLPSREQLEETLSHYSGTLLAVSHDRYFLEKTTNSKLVISDNG
IEKQLSDVPSERNDREELRLKLETERQEVLGKLSFMTPNDKEYEELDQAFNELTKRMKEL
DQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatcgtaacattaacaaatgtcagctatgaagtgaaggatatgactgttttt
aaaaacgtaaatgccagtattcagcagggagatatcattgggattatcggcaaaaatggc
gctgggaaatctacgctgctgcacctcatacacaatgacttaactcctgcacagggacaa
atccttcggcaggagttaaaaatgacgttggttgaacaggaaaccgcgtcgtattgcttt
gcggatcagacgcctgccgaaaagaaattactggagaaatggcgtgtgcccgtccgggat
ttccaacagttaagcggcggtgaaaaactgaaagcacggctggcgaaaggactatcagag
gatgcagatcttttactattagatgaaccgacaaaccaccttgataaagaaagcttgcaa
tttctcattcaacagctgaaaagttatagaggcactgtgattcttgtttcccatgatcgt
tattttttagacgaagctgcaacaaaaatatggtcgcttgaagctcaaaccctgattgaa
ttcaaaggaaattactctgggtatatgaagtaccgagaaaagaaaagactcgcccagcag
cgtgaatatgaaaagcagcaaaaaatggttgaacggattgaagcacaaatgaatgagctt
gcttcatggtcggaaaaagcccacgcccaatcgacgaaaaaggaagggtttaaagaatat
caccgtgtaaaagcgaagcgtacggatgcccaggttaaatctaagcagaagcggcttgaa
caagaactggaaaaagtaaaggcggaacccgttgagccgaaatatactgtccgcttttca
attgatacaaccaaaaaaacaggaaaacgttttttagaagttcagcatgtaacgaaggct
tttggcgaaagaaccctgtttaaaaacgcacattttacaattcagcacggcgaaaaggtt
gcgatcataggccccaatggcagcggaaaaacaacattactgaaaatcattctgggacag
gaaaccgctgagggaagtgtgtgggtgtcaccgtccgcaaatatcggctatttaacgcag
gaggtgtttgatttacctttagaacaaacaccggaagagttatttgagaatgaaacatac
aaagcaagagggcacgttcaaagtctgatgaggcacttaggttttactgcttcccaatgg
actgagccaatcaagcatatgagtatgggtgaacgtgtaaaggtcaagctgatggcatat
attctggaggagaaagacgtgctgattttagatgagccgacaaaccatctcgacctgccg
tcacgcgaacaactggaagaaacactgtcacactatagcggcacattgctggcggtttca
catgaccgatactttctcgaaaaaacaacaaacagtaaactcgtcatctcggacaatggc
atcgaaaagcaattgagtgacgttccatcagaaagaaatgaccgggaagagcttcgttta
aagcttgaaacagaaagacaagaagtgctgggaaagctcagttttatgacgccgaatgat
aaagagtacgaggagcttgatcaggctttcaatgagcttacgaaacgaatgaaagagctg
gatcagtag

DBGET integrated database retrieval system