KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0842Help
Entry
GYO_0842          CDS       T01635                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bst00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757573..758970
Genome map
AA seq 465 aa AA seqDB search
MAQTEQYRFPKDFWWGSSASATQTEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPAATSR
FYDNYKEDIRLMKELGHNSFRMSISWSRLIPDGIGEINVKAVDFYSSVIDELIVNGIEPF
VNLFHFDMPMELQKNGGWVNRETVAAYENYAKTSFRLFGDRVKKWFTHNEPIVPVEGGYL
YDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADV
RAGEIADAFFNRSFLDPSVKGEFPKELVEILKSEGFLPCYKKEDLEVIKHNTVDLLGVNY
YQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYG
NIECFISENGMGVEGEERFRDEQGIIQDDYRIEFMKEHLKWIHRAIQEGSNVKGYHLWTF
MDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKKVAEQHGF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttggcacaaacagaacaatatcgttttccgaaagatttttggtggggctcgtccgcttca
gcaacacaaacggagggtgccgccgatagagacggaaaagggcagaatatatgggattat
tggtttgaaaaagaaccgcatcgtttttttgatcatgtcgggcctgcagctacatctcga
ttttacgacaactataaagaagatatcaggctgatgaaggagcttggccacaactcgttc
cgaatgtcgatttcctggtcgcgtttaataccggacggaataggcgagatcaatgtcaaa
gccgtggatttttatagtagtgtcattgatgagttgatcgtgaacggaatagaacctttt
gtcaatttgtttcattttgatatgccgatggaacttcaaaaaaacggcggctgggtaaac
agagaaacggttgccgcttatgaaaactatgcgaaaacaagctttcgtttatttggcgat
cgggtgaaaaaatggtttacgcataatgaaccgatcgtcccagtagaaggcggatactta
tatgattttcattatccaaacaaggttgattttaaagaagccgtccaggtcggatttcac
acaatgctatcaagtgcccgagccattcaggcttacagggagatgaagcaggacggaaaa
atcggcatcatcttaaatttgaccccttcatacccaagaagcagccatccggcggatgta
agagcaggggaaatagcagacgcgttttttaacagatcctttttagacccttctgtcaaa
ggggaattcccaaaagagctggttgagattttaaagagcgaaggctttttgccctgctat
aagaaagaagatcttgaggtcatcaaacacaatacggttgatctgttgggtgtgaattat
tatcagccgagacgtgtaaaggcaaaagaacatcttccgaatcccgacgctccttttttg
cccgacaggtattttgatccttacgtcatgccgggccgcaaaatgaatcctcatcgcggc
tgggagatttacgaaaaaggcgtttatgatattttgatcaatttaaaagaaaactacggg
aacatcgagtgctttatttctgaaaacgggatgggagttgaaggcgaggaacgcttcagg
gatgaacaaggcattattcaagatgattaccggattgaatttatgaaagagcacctcaaa
tggattcaccgtgccatacaggaaggatcaaatgtaaaaggctatcacttatggacgttc
atggacaactggtcttggacaaatgcctataaaaaccgatacgggtttgtgtcagtcaac
ctcgagaaagacggggaaaggaccgtcaaaaagagcggaaaatggttcaaaaaggttgct
gagcaacacggtttctag

DBGET integrated database retrieval system