KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0973Help
Entry
GYO_0973          CDS       T01635                                 

Definition
(GenBank) putative glucosidase LplD
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00052  Galactose metabolism
bst00561  Glycerolipid metabolism
bst00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GYO_0973
  Lipid metabolism
   00561 Glycerolipid metabolism
    GYO_0973
   00600 Sphingolipid metabolism
    GYO_0973
Enzymes [BR:bst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GYO_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEP85655
UniProt: G4NRA5
Position
895958..897298
Genome map
AA seq 446 aa AA seqDB search
MCHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEEIGNHS
GDGRWRYEAVSTLKKALSGADIVIISILPGSLEDMEIDVHFPERCGIYQSVGDTVGPGGI
IRGLRAVPMFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLAEMVTERLGVEVLRREDIRVNVLGINHFTWITEASYRHIDLLPIFHEFSAHYGESGY
ELEGESWRDSVFRSAHRVAFDLFEMYGAIPAAGDRHLAEFLPGPYLKQPELWKFHLTSVS
FRKQDRDEKRKETERLIVQKRGVAGKASGEEGVNIIAALLGLGEIVTNVNVPNQGQVSNL
PLQAIVETNALITRNSVQPIFSGALPKGVEMIATRHVSNQEAVAESGLTKDRGLAFQAFL
NDPLVTIDRSDAEQLFDHMLAKHQLM
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtcatatcagtacgttagatcaaattaaaatcgcctatatcggcggggggtctcaa
ggctgggccagaagcctgatgagtgatctgtcgattgatgaacggatgtcaggcacagtg
gcgctttatgatcttgattttgaagccgctcagaaaaatgaagagatcggcaatcacagc
ggagacggcagatggaggtatgaagcggtttctactttgaaaaaggcgttatcgggcgcg
gatatcgtcattatttccattttgccgggttcactggaagatatggaaatcgatgtccac
ttccctgagcgctgcggcatttatcagtctgtgggtgatactgtcgggccgggcgggatc
atcagaggcttgcgggctgttccgatgtttgccgaaattgcccgggccataagagactac
gcaccagaatcatgggtcataaattatacaaacccaatgtctgtctgtacaagagtgctg
tataaagtgtttccgggcatcaaagcgattggctgctgccacgaggtattcggcacgcaa
aagctgctggcggaaatggtcacagaaaggctcggagtagaggtgctgcggcgcgaagat
attcgcgtcaatgtactcggcattaaccatttcacatggatcacggaagcctcttaccgc
catattgatctgctgcctatattccatgaattcagcgcgcattatggagaatcaggatat
gagctagagggggaaagctggagggacagcgtctttcgttcggcacaccgtgttgcgttt
gatttatttgaaatgtatggcgccatccccgctgcgggtgacaggcatctggcagagttt
cttcccggcccttacctcaaacagcctgagttatggaaatttcatctcacatctgtatca
ttcagaaaacaagacagagacgaaaaacgaaaagaaacagaacgattaatcgttcaaaaa
cggggcgttgccgggaaagcctcgggagaagaaggcgtgaacatcatagcggctctcctc
ggattgggtgaaatcgtcacgaatgtaaatgtgccgaatcaagggcaagtttccaatctt
cctttacaagcgattgtcgaaacgaacgccttgattacccgcaacagcgtccagccgatt
ttctctggagcgctgccaaagggtgtggaaatgattgcgacgaggcacgtatccaatcag
gaggcagtggcggaatctggtttaacaaaagatcgcggccttgcatttcaggcgtttctc
aatgatccgcttgtcacgattgaccgcagtgatgcagagcagcttttcgatcacatgctg
gcaaagcaccaactgatgtga

DBGET integrated database retrieval system