KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0986Help
Entry
GYO_0986          CDS       T01635                                 

Definition
cytochrome P450 family (EC:1.-.-.-)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    GYO_0986
  Amino acid metabolism
   00380 Tryptophan metabolism
    GYO_0986
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GYO_0986
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     GYO_0986
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     GYO_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907391..910576
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTYGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFDYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDFQDKLMVRTKRQFHHDIQTMFSLVDSIIAERRSNGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPDKLEKAYEEVDRV
LTGAAPTYKQVLELKYIRMILNESLRLWPTAPAFSLYPKEDTVISGKYPITTKDRISVLI
PQLHRDQDAWGEDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMV
LKYFTLIDHENYELDIKQTLTLKPGDFRIRVQTRHQEAIHADVPAAEKAAPDEQKEKTET
KGASVIGLNNRPLLVLYGSDTGTAEGVARELADTASLHGVRTEVAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWTDAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASISENRELQSADSDRSTRHIEITLPPDVEYREGDHLGVLPRNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAASRAQIREL
AAFTVCPPHKRELEDLATEGIYQEQILKKRISMLDLLEQYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPEQASITVGVVHGPAWSGRGEYRGVSSNYLAERQAGDDVVMFVRTPESR
FQLPEDPETPIIMVGPGTGVAPFRGFLQARAALKREGKALGEAHLYFGCRNDHDFIYRDE
LEQFEKDGIVTVHTAFSRKEGMPKTYVQHLMADHAETLISILDRGGRLYVCGDGSKMAPD
VEAGLQKAYQSVHGTGEQEAQNWLKHLQDTGIYAKDVWSGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagcctaagacctatggtccgctcggcaatctgcct
ttaattgataaagacaaaccgacactgtcgctgatcaaattggcagaagagcagggcccg
atttttcaaatccatacacctgcgggcacgacgattgtagtgtccggacacgaactggtg
aaagaagtttgtgatgaagagcgattcgacaaaagcattgaaggcgccttggagaaggtt
cgcgcgttttccggtgatggattgtttacaagctggacgcatgagcctaattggagaaaa
gcacacaacattctgatgccgacgttcagccagcgggccatgaaggactaccatgagaaa
atggtcgatatcgccgttcagctcattcaaaaatgggccaggcttaacccgaatgaagca
gtcgatgtcccaggggatatgacccggctgacgctcgacacaattgggctgtgcgggttt
gactatcgctttaacagctactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgctggatgaagcgatgcaccagatgcagcgtcttgattttcaagataagcttatg
gtcagaacaaagcgccaatttcatcatgatattcaaacaatgttttcattagtcgacagc
attattgcggaacggagatcgaatggagatcaggatgaaaaagatttgcttgcccgcatg
ctgaatgtggaagatccggaaacaggtgaaaagctcgacgatgaaaatatccgctttcaa
atcattacgtttttgattgccgggcatgaaacaacgagcggactgctttcctttgcgatc
tactttttattgaagcatcctgacaaactggagaaagcgtatgaagaggtcgaccgggtg
ctgacgggtgcagcgccgacctataaacaagtgctcgagctgaaatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacggctccggctttcagcctttatccaaaagaa
gacacagtcattagcggaaagtatccgattacaaccaaagatagaatttctgtgctgatt
ccgcagcttcatcgtgatcaagacgcttggggagaggacgctgaagaattccgtccagaa
cggtttgaacatcaggaccaagtgcctcatcatgcgtacaaaccgttcggaaatggacag
cgggcctgtatcggcatgcagtttgcccttcatgaagctacacttgtgctgggcatggtt
ttaaaatatttcacgttaattgatcatgagaattatgagcttgatatcaaacaaacctta
acactcaagccgggcgattttcgtatcagggttcaaacacggcatcaggaagccattcat
gcggacgttccggcagctgaaaaagcggcgcctgatgagcaaaaagagaaaacggaaaca
aagggcgcatcggttatcggtcttaacaaccgcccgcttctcgtgctgtacggatctgat
accggcaccgcagaaggcgtagcccgcgagcttgccgatacagccagtcttcatggcgta
aggactgaagtggcacctctgaacgaccggattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataacggaaaaccgccaagcaatgccggacagttcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgaaggcgtccattacgcggtatttggctgc
ggtgaccacaactgggcgagcacgtaccagtacgtgccgagattcattgatgagcagctt
gcggagaaaggcgcgactcggttttctgcgcgcggagagggggatgttagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtggacagacgccatcaaagcattcgga
cttgagcttaatgaaaacgccgataaggaacgaagcacactaagccttcagtttgtcaga
gggctgggcgagtctccgctggctagatcgtacgaagcctctcacgcatccatttccgaa
aatcgtgaactccagtccgcagacagtgatcgcagcacccgccatatcgaaatcacattg
ccgccggatgttgaatatcgggagggcgatcaccttggcgtattgccgaggaacagccaa
accaatgtcagccggattcttcacagattcggcctgaagggaaccgaccaagtgacattg
tcggcaagcgggcgcagtgcggggcatctgccattagggcgtcctgtcagcctgcatgat
cttctcagctacagcgtcgaggtgcaagaagccgcctcaagggcgcaaatacgggagctg
gcggcatttacagtctgtccgccacataagcgcgaattagaagatctggcgacagagggt
atctatcaggaacaaatattgaaaaaacggatttctatgctggatctgcttgaacaatat
gaagcgtgtgatatgccgtttgaacgatttctagagcttttacggccgttaaaaccgaga
tattattcgatttcaagctctccaagggtaaatcctgagcaagcatcaattacagttggt
gtcgtgcacggccctgcgtggagcggccgcggcgaatacaggggcgtatcttcaaattac
ttagctgagcgtcaagcgggtgatgatgttgtgatgtttgtccgcacaccggaatcccgg
tttcagcttccggaagaccctgaaaccccaatcattatggtcgggccgggcacaggagta
gcgccattccgcggtttcctccaagcacgcgcagctttaaagcgggagggaaaagcgctc
ggcgaagctcatctctattttggatgcaggaacgatcatgattttatttaccgtgacgag
cttgagcagtttgaaaaagatggaatcgtcactgtccacacagccttttcccgaaaagaa
ggcatgccgaaaacgtatgtccagcatctcatggctgaccatgcagaaacattgatttcg
attcttgatcgcggaggcaggctctatgtatgcggtgatggcagcaaaatggccccagat
gtggaggccggactgcaaaaagcgtatcagtctgttcatggcaccggtgaacaagaagca
caaaactggctgaaacatctgcaggataccggtatatatgcaaaagatgtttggtcgggg
atttaa

DBGET integrated database retrieval system