KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1077Help
Entry
GYO_1077          CDS       T01635                                 

Definition
acetoin cleaving system dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYO_1077
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_1077
   00020 Citrate cycle (TCA cycle)
    GYO_1077
   00620 Pyruvate metabolism
    GYO_1077
Enzymes [BR:bst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GYO_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
994310..995506
Genome map
AA seq 398 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSIWNKKVGDPVEKGESIASIQSEKIEMDIEAPEKGTLIDIK
VKEGEEVPPGTAICYIGDANESVQEEASAPAAEDSVPQAVQPVKQENKPAASKKERIKIS
PVARKIAEKAGLDLKQLKGTGPGGRIVKDDVTKALAEQKNDRTEPVSEQKAQETPVTGMR
KVIAARMQESLANSAQLTITMKADITKLAALQKQLSPTAEERYGTKLTITHLVSRAAVLA
LQAHPALNSFYQNERIITHPHVHLGMAVALENGLVVPVIRNADKKSLIELAQSISENAKK
AREGRAGSEELQGSTFSITNLGAFGVEHFTPILNPPETGILGIGASYDTPVYQGEEIVRS
TILPLSLTFDHRACDGAPAAAFLKAIKTYLEEPAALIL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaaaagtagtgatgccaaaattgggaatggccatgaaacaaggggaagtatcg
atatggaataaaaaagtaggcgacccggttgaaaagggagaaagcattgccagcattcaa
tcggagaaaattgaaatggacatcgaggcgcctgaaaaaggaacgctgatcgatatcaaa
gtaaaagagggggaggaggtcccgcccggcacagcgatctgctacatcggggacgccaat
gaatcggtgcaggaagaggcgagcgcgcctgctgctgaagacagtgtgccgcaagccgtc
cagcccgtcaaacaagaaaacaaacccgcagcctccaaaaaagaacgaatcaaaatatct
ccagtcgccaggaaaatagcagaaaaggcaggattagacctgaaacagctgaaaggtact
ggaccaggcggacgaatcgtgaaggacgacgtgacaaaagcgcttgctgaacagaaaaat
gatcggacagagccggtttctgagcagaaggcgcaagaaacgccggtgacaggcatgaga
aaagttatcgcggccagaatgcaggaaagcctggcaaacagcgcgcagctgacgattacg
atgaaggctgatatcaccaagctggcagcccttcaaaaacagctttctccaacagccgaa
gagcggtacggcacaaagctgacgatcactcatttggtctcaagagccgccgttctcgct
ctgcaagctcatcctgcgctgaacagtttttatcaaaatgagcgcatcatcacacatcct
catgtgcacctcggaatggctgtggccttggaaaatggattagttgtgcctgtgatccgc
aacgctgataagaaatcgctgattgaactggctcaatccatctccgaaaatgcaaaaaaa
gcacgcgaggggcgggcgggaagcgaagaactgcaaggctcaaccttctccattacaaac
cttggcgcttttggagtggagcattttacgccgatattaaatccgccggaaacaggcatt
ctcggcatcggagcaagctatgacacgccggtgtatcaaggggaggagattgtcagaagc
acgattcttccgctcagcctgacatttgaccacagagcgtgtgacggcgcccctgccgct
gcattcctgaaggcgattaaaacatatttggaagaacccgcagcattaattttatag

DBGET integrated database retrieval system