KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1310Help
Entry
GYO_1310          CDS       T01635                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYO_1310 (hemG)
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GYO_1310 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201213..1202625
Genome map
AA seq 470 aa AA seqDB search
MSDGKKHVVIIGGGITGLAAAFYMEKEIIEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKTSAPQLVKDVGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSVSGKARAAMDFILPASKSKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKISRGGTGYSLDLDNGVTLDAESVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGAVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALASAYPGVYVTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggtttagccgcc
gccttctatatggaaaaagaaatcatagaaaaaaatctgccccttgagctgacgcttgtt
gaggcaagtccgagagtcggcgggaaaattcaaactgtcaagaaagacggctatatcatc
gaaagagggcctgactcatttctggaacggaagacaagcgctccgcagcttgtcaaagat
gtcggccttgaacatttgcttgtcaacaatgcgacgggacaatcctatgtgcttgtaaac
cgcaccctgcatccaatgccgaagggcgccgtgatggggataccgacaaaaattgcgccg
ttcgtttcaaccggtctgttttctgtgtctgggaaggcaagggctgctatggatttcatc
ctgcctgcaagcaagtcaaaagacgaccagtcattgggagaatttttccgcagacgtgtc
ggagatgaagtggttgagaatttaatcgagccccttctatcaggcatctacgctggcgac
attgacaagctcagcctaatgtcgacttttccgcaattttaccagacggaacaaaagcac
agaagcttaattctcggcatgaaaaaaacaaggcctcaaggctccggccagcagctcacg
gctaaaaagcaagggcagttccagaccctttcaacgggtttgcagacccttgtcgaagag
atcgaaaaacaattaaagctgacgaaggtatacaaagggacaaaagtgaccaagatcagc
cgcggcggcactggctactcgctcgatctggataacggcgtcacacttgatgctgaatca
gtgattgtgactgctccgcataaagcggctgcaggaatgctttctgagcttcctgccatt
tctcatttaaaaaatatgcactccacatccgtggcaaatgtcgccttgggtttccctgaa
ggcgcagtccaaatggagcatgagggaacgggctttgttatctcaagaaacagtgatttc
gcgatcacagcctgtacgtggacgaacaaaaaatggccgcacgcagcgcctgaaggcaaa
acgctgcttcgggcatatgtcggaaaagccggagacgaatcgattgtcgatctctcagat
aacgacattatcaacatcgtgttagaagacttaaagaaagtcatgaacataaacggggag
ccggaaatgacatgtgtcacccgctggcatgaaagcatgccgcagtaccatgtcggccat
aagcagcgcatcaaagaactgcgcgaagcactggcctctgcatatccgggtgtctatgtg
acaggcgcttcttttgaaggtgtcggaattcccgactgcattgatcaaggaaaagctgcc
gtgtctgacgcgcttacctatttattcagctga

DBGET integrated database retrieval system