KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1328Help
Entry
GYO_1328          CDS       T01635                                 

Definition
(GenBank) subtilisin amylosacchariticus (EC:3.4.21.62)
  KO
K01342  
subtilisin [EC:3.4.21.62]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:bst00001]
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    GYO_1328
Enzymes [BR:bst01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     GYO_1328
Peptidases [BR:bst01002]
 Serine Peptidases
  Family S8: subtilisin family
   GYO_1328
Chaperones and folding catalysts [BR:bst03110]
 Intramolecular chaperones
  Subtilisin family
   GYO_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1217477..1218622)
Genome map
AA seq 381 aa AA seqDB search
MRNKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVIS
EKGGKIQKQFKYVNAATATLNEKAVKELKQDPSVAYVEEDHIAHEYAQSVPYGISQIKAP
ALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA
LNNSIGVLGVAPNASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPSGSTA
LKTVVDKAVSNGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGP
ELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTA
TYLGSSFYYGKGLINVQAAAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaacaaaaaattgtggatcagcttgttgtttgcgttaacgttaatctttacgatg
gcgttcagcaacatgtctgcgcaggctgccggaaaaagcagtacagaaaagaagtacatt
gtcggatttaaacagacaatgagtgcaatgagttccgctaagaaaaaagatgttatttct
gagaaaggcggaaaaattcaaaagcagtttaagtatgttaacgcagccacagcaacattg
aatgaaaaagctgtaaaagaattaaaacaagatccgagcgttgcatatgtggaagaagat
catattgcacatgaatatgcgcaatctgttccttacggcatttctcaaattaaagcgccg
gctcttcactctcaaggctacacaggctctaacgtaaaagtagctgttatcgacagcgga
attgactcttctcatcctgacttaaatgtcagaggcggagcaagcttcgtaccttctgaa
acaaacccataccaggacggcagttctcacggcacgcatgtagccggtacgattgccgct
cttaataactcaatcggtgttctgggcgtagcaccaaacgcatcgttatatgcagtaaaa
gttcttgattcaacaggaagcggccaatacagctggattattaacggcattgagtgggcc
atttccaacaatatggacgttatcaacatgagccttggcggaccttctggttctacagcg
ctgaaaacagtagttgataaagccgtttccaacggtatcgtcgttgctgctgcggccgga
aacgaaggttcgtccggaagcacaagcacagtcggctaccctgcaaaatatccttctacc
attgcggtaggtgcggtaaacagcagcaaccaaagggcttcattctcaagcgcaggtccc
gagcttgatgtgatggctcctggcgtatccattcaaagcacacttcctggaggcacttac
ggcgcttacaacggaacgtctatggcgactccgcacgttgctggagcagcagcgttaatt
ctttctaagcacccgacttggacaaacgcgcaagtccgtgatcgtttagaaagcactgca
acataccttggtagctctttctactatggaaaagggttaatcaacgtacaagcagctgca
caataa

DBGET integrated database retrieval system