KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1328Help
Entry
GYO_1328          CDS       T01635                                 

Definition
subtilisin (EC:3.4.21.62)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1217477..1218622)
Genome map
AA seq 381 aa AA seqDB search
MRNKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVIS
EKGGKIQKQFKYVNAATATLNEKAVKELKQDPSVAYVEEDHIAHEYAQSVPYGISQIKAP
ALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA
LNNSIGVLGVAPNASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPSGSTA
LKTVVDKAVSNGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGP
ELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTA
TYLGSSFYYGKGLINVQAAAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaacaaaaaattgtggatcagcttgttgtttgcgttaacgttaatctttacgatg
gcgttcagcaacatgtctgcgcaggctgccggaaaaagcagtacagaaaagaagtacatt
gtcggatttaaacagacaatgagtgcaatgagttccgctaagaaaaaagatgttatttct
gagaaaggcggaaaaattcaaaagcagtttaagtatgttaacgcagccacagcaacattg
aatgaaaaagctgtaaaagaattaaaacaagatccgagcgttgcatatgtggaagaagat
catattgcacatgaatatgcgcaatctgttccttacggcatttctcaaattaaagcgccg
gctcttcactctcaaggctacacaggctctaacgtaaaagtagctgttatcgacagcgga
attgactcttctcatcctgacttaaatgtcagaggcggagcaagcttcgtaccttctgaa
acaaacccataccaggacggcagttctcacggcacgcatgtagccggtacgattgccgct
cttaataactcaatcggtgttctgggcgtagcaccaaacgcatcgttatatgcagtaaaa
gttcttgattcaacaggaagcggccaatacagctggattattaacggcattgagtgggcc
atttccaacaatatggacgttatcaacatgagccttggcggaccttctggttctacagcg
ctgaaaacagtagttgataaagccgtttccaacggtatcgtcgttgctgctgcggccgga
aacgaaggttcgtccggaagcacaagcacagtcggctaccctgcaaaatatccttctacc
attgcggtaggtgcggtaaacagcagcaaccaaagggcttcattctcaagcgcaggtccc
gagcttgatgtgatggctcctggcgtatccattcaaagcacacttcctggaggcacttac
ggcgcttacaacggaacgtctatggcgactccgcacgttgctggagcagcagcgttaatt
ctttctaagcacccgacttggacaaacgcgcaagtccgtgatcgtttagaaagcactgca
acataccttggtagctctttctactatggaaaagggttaatcaacgtacaagcagctgca
caataa

DBGET integrated database retrieval system