KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1337Help
Entry
GYO_1337          CDS       T01635                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYO_1337
   00630 Glyoxylate and dicarboxylate metabolism
    GYO_1337
   00640 Propanoate metabolism
    GYO_1337
   00650 Butanoate metabolism
    GYO_1337
  Lipid metabolism
   00071 Fatty acid degradation
    GYO_1337
   00072 Synthesis and degradation of ketone bodies
    GYO_1337
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GYO_1337
   00310 Lysine degradation
    GYO_1337
   00380 Tryptophan metabolism
    GYO_1337
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GYO_1337
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GYO_1337
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GYO_1337
Enzymes [BR:bst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GYO_1337
Exosome [BR:bst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYO_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1222554..1223648)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGKQNGLLKPFLPEDLAAPIISCLSRKLGDQIDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGVGTMYIAGGSESSSQSPFSER
ARFSPNAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDGGFYREEIVPLGE
LEMDEAFLKKRPIEAIISRAKPIFDTSSGTVTAANSSGISDGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRKLLTAHDVTPDDIDLYEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYETQRRTDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgcggttattgttgatgcaaaacgaacgatctttggaaaacaaaatgggctgcta
aagccctttctaccggaggatttggcggctcccatcataagctgtctcagccgaaagcta
ggggatcaaattgatgaagtgattctcggaaacgcgaccggcagaggcggcaacctcgct
aggctgtcagctctgcaagccggactgcctttatcggttcccggtatgacgattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagtctcattcaagccggagtc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcacctttttcagaacgg
gcccgcttttctccaaatgcgatcggtgatcccgacatgggcatcgcagccgaatatacg
gcagcacgctattccatcagcagaagcatgcaggatgaatacgcgcttctcagccatcaa
cgcagcagaaacgcgcatgatggaggattttaccgtgaagaaattgttcctctcggcgaa
ttggagatggatgaagcatttctgaaaaagcggccgatagaagcgattatttcccgtgca
aaaccgattttcgacaccagctccggaacggttacagcagccaacagcagcggcatatca
gacggagcggccgctctccttgtaatggaagaagaaaaagctgcagccctagggcttaag
ccagtgctccggtttatcggcagtgctgtcagcgggattcacccgaactatccgcccgcg
gcgccggttgatgcgatccggaagcttttaactgcacacgatgtaacacctgatgatatc
gatttatatgagatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcatccccttttcaaaaatcaatgtgcgcggcggcgcattagctctcggccatccgtac
ggcgcatcgggtgcagctctggtaaccagattgttttatgaaacgcaaagacggacagac
tgtcaatatgccgttgcggccatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system